PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aqcoe2G244700.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 169aa MW: 18883.7 Da PI: 10.1663 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 97 | 1.9e-30 | 86 | 167 | 2 | 84 |
Whirly 2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakg 84 v+k+kaal+v + +p+f++ + k +++G +ll++ +a++erkydW+k+q als+tev++l++l + +sceffhdp++k+ Aqcoe2G244700.1.p 86 VFKGKAALSVYPLLPKFNES-ETSSKYDKKGCILLKFWPAIGERKYDWQKRQMIALSPTEVGSLISLEPGKSCEFFHDPSMKS 167 9*****************99.567899*****************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 6.3E-37 | 72 | 167 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 1.49E-29 | 77 | 167 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 4.6E-32 | 86 | 167 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
QLHTLHSPLS TLHSTPSPLL SSFPSPLRYP DTISKMMKLS YFVRSRSAVS EKVAGKVSNT 60 SNALWTHCFT TQAGTRSNQI FADYTVFKGK AALSVYPLLP KFNESETSSK YDKKGCILLK 120 FWPAIGERKY DWQKRQMIAL SPTEVGSLIS LEPGKSCEFF HDPSMKSR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3n1h_A | 4e-36 | 72 | 167 | 3 | 99 | StWhy2 |
3n1i_A | 4e-36 | 72 | 167 | 3 | 99 | protein StWhy2 |
3n1j_A | 4e-36 | 72 | 167 | 3 | 99 | Protein StWhy2 |
3n1k_A | 4e-36 | 72 | 167 | 3 | 99 | protein StWhy2 |
3n1l_A | 4e-36 | 72 | 167 | 3 | 99 | protein StWhy2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010912668.2 | 9e-45 | single-stranded DNA-binding protein WHY2, mitochondrial | ||||
Swissprot | D9J034 | 4e-36 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
TrEMBL | A0A2G5DUB0 | 2e-93 | A0A2G5DUB0_AQUCA; Uncharacterized protein | ||||
TrEMBL | A0A2G5DUG0 | 3e-93 | A0A2G5DUG0_AQUCA; Uncharacterized protein | ||||
TrEMBL | A0A2G5EY60 | 6e-94 | A0A2G5EY60_AQUCA; Uncharacterized protein | ||||
STRING | Aquca_003_00282.1 | 1e-94 | (Aquilegia coerulea) | ||||
STRING | Aquca_014_00047.1 | 4e-94 | (Aquilegia coerulea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 4e-36 | WHIRLY 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aqcoe2G244700.1.p |