PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco024560.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MYB
Protein Properties Length: 181aa    MW: 20411.6 Da    PI: 5.3784
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco024560.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.11.9e-081255445
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     W+  Ed+l+ +a   ++ g   +W+++a +++ gRt+ ++  ++ 
      Aco024560.1 12 WSRTEDKLFENALVIFPEGtanRWALVAGHVP-GRTPREVWAHYC 55
                     ********************************.*****9988886 PP

2Myb_DNA-binding48.12.7e-15114158347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++++ +++G+g+W+ I+r   k+Rt+ q+ s+ qky
      Aco024560.1 114 PWTEEEHRLFLEGLAKYGKGDWRNISRWAVKTRTPTQVASHAQKY 158
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.252162IPR017930Myb domain
SMARTSM007171.0E-6860IPR001005SANT/Myb domain
SuperFamilySSF466897.9E-121065IPR009057Homeodomain-like
CDDcd001675.82E-61258No hitNo description
Gene3DG3DSA:1.10.10.602.8E-51257IPR009057Homeodomain-like
PfamPF002497.1E-71256IPR001005SANT/Myb domain
PROSITE profilePS5129419.347107163IPR017930Myb domain
SuperFamilySSF466893.04E-18109163IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-17110162IPR006447Myb domain, plants
SMARTSM007176.4E-11111161IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-12113157IPR009057Homeodomain-like
PfamPF002492.0E-12114158IPR001005SANT/Myb domain
CDDcd001679.00E-11114159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MEFFGEPAGP GWSRTEDKLF ENALVIFPEG TANRWALVAG HVPGRTPREV WAHYCELVQD  60
VEMIEQGRVE VPVYGDGDDD DDYDGGEAEP SGSDRTAQVG GSRARAEERK RGVPWTEEEH  120
RLFLEGLAKY GKGDWRNISR WAVKTRTPTQ VASHAQKYFI RQNQNARESK RKSIHDITIP  180
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A8e-14874773RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3679545e-53AK367954.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2065H11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020087431.11e-132transcription factor DIVARICATA-like
SwissprotQ8S9H74e-51DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A199UUT91e-115A0A199UUT9_ANACO; Transcription factor DIVARICATA
STRINGXP_008808839.19e-66(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.15e-53MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]