PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco022092.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MYB
Protein Properties Length: 419aa    MW: 45961.8 Da    PI: 6.2884
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco022092.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
      Aco022092.1 14 KGLWSPEEDEKLINHITKYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.81.4e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E++l+v++++ lG++ W+ Ia+ ++ gRt++++k+ w++
      Aco022092.1  67 RGTFSEQEEKLIVELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      899*******************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.4E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.063965IPR017930Myb domain
SuperFamilySSF466894.87E-2912108IPR009057Homeodomain-like
SMARTSM007173.3E-131363IPR001005SANT/Myb domain
PfamPF002492.2E-151461IPR001005SANT/Myb domain
CDDcd001674.28E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.61666116IPR017930Myb domain
SMARTSM007171.9E-1266114IPR001005SANT/Myb domain
PfamPF002492.1E-1367110IPR001005SANT/Myb domain
CDDcd001672.72E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLINHIT KYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SEQEEKLIVE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQRG  120
IDPNTHKPLA ETEGSNGEDG APTNSDKTGG SADRNCLSVS AKCSPVELEK NSMAAPTKEF  180
FLDRLVGSPS GDGRPSSNTL GYFSLPQLSY GPDYASSPTP LPWFSQSGRH FDTNPEFNYS  240
AISTIIPSVP TSIVSTSMGL NLPSPGCTGI GGVPYWEAGN PSSSTSGSSS GNNANNNNNN  300
NSNSSSYGRF EMQSSGSFYE GGGFLPWLDL AAERDASHDV QIADEPEDLK WSEYLHGSFP  360
INQTHSLFDD IKAEETQFAF DGLTGWHQNQ QPPQQQHLSA ADMYGKDLQK VSLAFEQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020085702.10.0transcription factor MYB86-like
RefseqXP_020085703.10.0transcription factor MYB86-like
RefseqXP_020085704.10.0transcription factor MYB86-like
TrEMBLA0A199V8Z20.0A0A199V8Z2_ANACO; Transcription factor MYB86 (Fragment)
STRINGXP_008775654.11e-133(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-88myb domain protein 61