PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco020863.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MYB
Protein Properties Length: 359aa    MW: 39774.1 Da    PI: 4.6687
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco020863.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92.1e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+ +++++G g+W++ ++  g+ R++k+c++rw +yl
      Aco020863.1 16 KGSWTPEEDMRLIAYIHKFGHGNWRALPKQAGLLRCGKSCRLRWINYL 63
                     799*****************************99************97 PP

2Myb_DNA-binding54.82.2e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
      Aco020863.1  69 RGNFTQEEEETIIKLHDLLGNK-WSKIASCLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8511163IPR017930Myb domain
SuperFamilySSF466893.52E-3113110IPR009057Homeodomain-like
SMARTSM007176.1E-141565IPR001005SANT/Myb domain
PfamPF002494.3E-161663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-241770IPR009057Homeodomain-like
CDDcd001671.24E-101863No hitNo description
PROSITE profilePS5129425.48664118IPR017930Myb domain
SMARTSM007173.9E-1568116IPR001005SANT/Myb domain
PfamPF002491.6E-1569114IPR001005SANT/Myb domain
CDDcd001671.52E-1071114No hitNo description
Gene3DG3DSA:1.10.10.607.1E-2771118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGRGRAPCCA KIGLNKGSWT PEEDMRLIAY IHKFGHGNWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDIKRG NFTQEEEETI IKLHDLLGNK WSKIASCLPG RTDNEIKNVW NTHLKKRLAS  120
RDHNIKKSKQ KEATSPSSSS TSTSCSDQGG TKCDGDGPNP KPDPMNPTLE KFEIPIEHNT  180
DTWGMLVDPI SSQPEDTDTG NMRSTIHIDS TSLSVSSCSS SSNSFETNSD TSNEARGALH  240
YIEMEEDEKD PLEILEIPIE PEFWTMIEDE HARLYSQEMG PTEEFGSKGN PAASEGNESN  300
SCEVNGWLEY LEKELGLGGG PSEENQESLV GSWTGEMEGD PVSSYFQKEP SISTLTVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-271411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020095247.10.0myb-related protein Zm1-like
TrEMBLA0A199VX530.0A0A199VX53_ANACO; Myb-related protein Zm1
STRINGXP_008776690.11e-129(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-68myb domain protein 63