PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco017589.1
Organism
Ananas comosus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 156aa    MW: 18242.9 Da    PI: 10.0693
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco017589.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.34.2e-28959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 k+ien +nrqvt+skRr+gi+KKA+EL vLCda+v++i+fsst+k+ ey+s
  Aco017589.1  9 KKIENPTNRQVTYSKRRTGIMKKAKELTVLCDADVSLIMFSSTNKFSEYCS 59
                 68***********************************************96 PP
2K-box82.68.9e-2871154184
        K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                  yq+ sg +l++a++e++q+ l+ Lk+ ++nL++e+R+++Ge+L+ L++ eL+ Leq+L+++lk +R +K++++++q+++ +kk 
  Aco017589.1  71 YQQVSGINLWSAQYERMQNTLNHLKEINSNLRKEIRQRMGEELDGLDFYELRGLEQNLDEALKVVRHRKYHVITTQTDTYKKKV 154
                  7899999***************************************************************************95 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.1E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.062161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.01E-38295IPR002100Transcription factor, MADS-box
CDDcd002651.42E-40280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.6E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-273859IPR002100Transcription factor, MADS-box
PfamPF014863.0E-1982154IPR002487Transcription factor, K-box
PROSITE profilePS5129714.07284155IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MGRGKIEIKK IENPTNRQVT YSKRRTGIMK KAKELTVLCD ADVSLIMFSS TNKFSEYCSP  60
STDTKKIFDR YQQVSGINLW SAQYERMQNT LNHLKEINSN LRKEIRQRMG EELDGLDFYE  120
LRGLEQNLDE ALKVVRHRKY HVITTQTDTY KKKVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A4e-19175173MEF2 CHIMERA
6byy_B4e-19175173MEF2 CHIMERA
6byy_C4e-19175173MEF2 CHIMERA
6byy_D4e-19175173MEF2 CHIMERA
6bz1_A3e-19175173MEF2 CHIMERA
6bz1_B3e-19175173MEF2 CHIMERA
6bz1_C3e-19175173MEF2 CHIMERA
6bz1_D3e-19175173MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of floral organs. Required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS4. {ECO:0000269|PubMed:12506001, ECO:0000269|PubMed:12905025, ECO:0000269|PubMed:14558657}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9360440.0JN936044.1 Guzmania wittmackii x Guzmania lingulata cultivar Ostara MADS-box2 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020082339.11e-110MADS-box transcription factor 16-like
RefseqXP_020095359.11e-110MADS-box transcription factor 16-like
SwissprotQ944S91e-87MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBLA0A199W5501e-111A0A199W550_ANACO; MADS-box transcription factor 16
STRINGXP_008781488.11e-101(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57283552
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.15e-61MIKC_MADS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Chen ZX, et al.
    Morphogenesis and molecular basis on naked seed rice, a novel homeotic mutation of OsMADS1 regulating transcript level of AP3 homologue in rice.
    Planta, 2006. 223(5): p. 882-90
    [PMID:16254725]
  3. Zhang Q, et al.
    Morphological, anatomical and genetic analysis for a rice mutant with abnormal hull.
    J Genet Genomics, 2007. 34(6): p. 519-26
    [PMID:17601611]
  4. Yoshida H, et al.
    superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice.
    Plant Biotechnol. J., 2007. 5(6): p. 835-46
    [PMID:17764519]
  5. Yao SG,Ohmori S,Kimizu M,Yoshida H
    Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development.
    Plant Cell Physiol., 2008. 49(5): p. 853-7
    [PMID:18378529]
  6. Xiao H, et al.
    STAMENLESS 1, encoding a single C2H2 zinc finger protein, regulates floral organ identity in rice.
    Plant J., 2009. 59(5): p. 789-801
    [PMID:19453444]
  7. Seok HY, et al.
    Rice ternary MADS protein complexes containing class B MADS heterodimer.
    Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
    [PMID:20888318]
  8. Li H, et al.
    Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate.
    Plant Cell, 2011. 23(7): p. 2536-52
    [PMID:21784949]
  9. Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T
    Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58.
    Plant Sci., 2012. 183: p. 183-9
    [PMID:22195592]
  10. Ohmori S,Tabuchi H,Yatou O,Yoshida H
    Agronomic traits and gene containment capability of cleistogamous rice lines with the superwoman1-cleistogamy mutation.
    Breed. Sci., 2012. 62(2): p. 124-32
    [PMID:23136523]
  11. Yun D, et al.
    OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice.
    Mol Plant, 2013. 6(3): p. 743-56
    [PMID:23300256]
  12. Lombardo F, et al.
    The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice.
    Plant Biotechnol. J., 2017. 15(1): p. 97-106
    [PMID:27336225]