PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aco012921.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 138aa MW: 14652.6 Da PI: 9.0414 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 64.3 | 1.4e-20 | 80 | 114 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++Cg+++TplWR gpdg+k+LCnaCG++yrk+++ Aco012921.1 80 CAWCGVISTPLWRTGPDGPKSLCNACGIRYRKEEM 114 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 3.1E-14 | 74 | 124 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.532 | 74 | 110 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 2.61E-13 | 77 | 119 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 5.5E-15 | 78 | 114 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.99E-12 | 79 | 134 | No hit | No description |
Pfam | PF00320 | 3.7E-18 | 80 | 113 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MEYYNFLGLS SSSSSSASAS SSSASSCSSI LSSSCLYSSS VSVNGVKVEK DLIGVLEERG 60 KYAGLDVSLS LRPPAPAKKC AWCGVISTPL WRTGPDGPKS LCNACGIRYR KEEMRLNTNL 120 TLGPSNPNAR RPRLFYD* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009385185.1 | 5e-27 | PREDICTED: GATA transcription factor 4-like | ||||
TrEMBL | M0RT57 | 1e-25 | M0RT57_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr11P17770_001 | 2e-26 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2418 | 38 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G36620.1 | 3e-16 | GATA transcription factor 19 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aco012921.1 |