PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco010274.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MYB
Protein Properties Length: 265aa    MW: 29353.7 Da    PI: 6.8918
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco010274.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding475.8e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l d++  +G  +W++++++ g+ R +k+c++rw +yl
      Aco010274.1 15 KGLWSPEEDQRLRDYILNHGLSCWSAVPAKAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding52.41.2e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eE+++   + +qlG++ W+ Ia++++ gRt++++k++w++yl
      Aco010274.1  68 RGIFSQEEEQIVMSLQAQLGNK-WSQIAAHLP-GRTDNEVKNYWNSYL 113
                      6889******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.471062IPR017930Myb domain
SuperFamilySSF466891.06E-2712109IPR009057Homeodomain-like
SMARTSM007179.2E-101464IPR001005SANT/Myb domain
PfamPF002493.9E-131562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-221669IPR009057Homeodomain-like
CDDcd001671.63E-81862No hitNo description
PROSITE profilePS5129425.09863117IPR017930Myb domain
SMARTSM007176.3E-1567115IPR001005SANT/Myb domain
PfamPF002491.1E-1468113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2570117IPR009057Homeodomain-like
CDDcd001674.18E-1171113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MGCRTCEKPK MNYRKGLWSP EEDQRLRDYI LNHGLSCWSA VPAKAGLQRN GKSCRLRWIN  60
YLRPGLKRGI FSQEEEQIVM SLQAQLGNKW SQIAAHLPGR TDNEVKNYWN SYLKKRVAKA  120
EGSAGSSSTI SSADSTGHNR NPRDEESNKI TPPLSTEPLE VSNLDSGQTI TTSSNQCSSS  180
KGAADALLPK VLFSDWLAFD QENNLSLPSL NDGSNCINWG SRSTCLYANE GLQMDQQFSS  240
EYEHEAAVQI PGGGFFDLLF MGGGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-26911723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020080041.10.0transcription factor MYB6-like
SwissprotQ9M0K44e-55LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A199V1T30.0A0A199V1T3_ANACO; Transcription factor LAF1
STRINGXP_008780142.18e-93(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.11e-56myb domain protein 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]