PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco003598.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MYB
Protein Properties Length: 275aa    MW: 31348.3 Da    PI: 8.6738
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco003598.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-174490148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     + +W++ Ed+ l  +vk++G  +W+ I r ++ gR++k+c++rw ++l
      Aco003598.1 44 KVPWSPHEDKMLRALVKKHGAQSWSIICRNIP-GRSAKSCRLRWCNHL 90
                     579*****************************.*************96 PP

2Myb_DNA-binding569.1e-1898138345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++T+eEd +++++++++ +g W+tIar+m+ gR+++ +k+rw+
      Aco003598.1  98 PFTPEEDSKIIELHRKYHNG-WATIARHMP-GRSDNAIKNRWN 138
                      89******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.6523994IPR017930Myb domain
SMARTSM007176.4E-154392IPR001005SANT/Myb domain
PfamPF002491.2E-154490IPR001005SANT/Myb domain
SuperFamilySSF466891.46E-3044137IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-184693IPR009057Homeodomain-like
CDDcd001671.77E-134690No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2194143IPR009057Homeodomain-like
SMARTSM007178.3E-1595143IPR001005SANT/Myb domain
CDDcd001675.24E-1298141No hitNo description
PROSITE profilePS5129417.90598145IPR017930Myb domain
PfamPF002492.8E-1598138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MALSKHTVLT SSPSSAVCAS EAKKEKGSQV PWSPPDAKKD KGSKVPWSPH EDKMLRALVK  60
KHGAQSWSII CRNIPGRSAK SCRLRWCNHL LPGLNFKPFT PEEDSKIIEL HRKYHNGWAT  120
IARHMPGRSD NAIKNRWNCT LKNRQRHEHE QPTKRKRSDD DHDDDGFGSK VAESWLPPKT  180
PQWEEIEPAE ICEPGCVSQK PPPPLELNFL AQDFSRWKKQ VFDRQRDFTG FKFDHGIDDP  240
MTALTLGYPG TPTESYSSDF SDEGRWKMES AIEY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26441447107B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020107289.10.0transcription factor MYB44-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.12e-38myb domain protein 70