PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aco001456.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 137aa MW: 14596.3 Da PI: 10.0889 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 120.5 | 6.1e-38 | 78 | 131 | 2 | 55 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggr 55 +e+alkcprCds+ntkfCyynnysl+qPr+fCk+CrryWt+GGalrnvPvGgg Aco001456.1 78 PEQALKCPRCDSANTKFCYYNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGX 131 7899************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 4.0E-32 | 62 | 130 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 4.0E-32 | 80 | 131 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 27.838 | 82 | 136 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 84 | 120 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MVFPSIPVYL DPPNWNQQLQ AHHIQPGSSA IGGGGNGPPP PLPLGAAAAP RPEAQPMSGA 60 SRPGSMSERA RLAKVPQPEQ ALKCPRCDSA NTKFCYYNNY SLTQPRHFCK TCRRYWTRGG 120 ALRNVPVGGG XSPSQP* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. {ECO:0000269|PubMed:12887587}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin and salicylic acid (SA). Repressed by jasmonic acid (JA). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:12887587}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK068542 | 4e-59 | AK068542.1 Oryza sativa Japonica Group cDNA clone:J013155H18, full insert sequence. | |||
GenBank | AP004303 | 4e-59 | AP004303.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0407H12. | |||
GenBank | AP014963 | 4e-59 | AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010937643.1 | 3e-62 | dof zinc finger protein DOF5.1 isoform X1 | ||||
Swissprot | Q9M2U1 | 8e-44 | DOF36_ARATH; Dof zinc finger protein DOF3.6 | ||||
TrEMBL | A0A1D1ZK93 | 2e-55 | A0A1D1ZK93_9ARAE; Dof zinc finger protein DOF3.6 (Fragment) | ||||
TrEMBL | A0A2H3X7L1 | 4e-55 | A0A2H3X7L1_PHODC; dof zinc finger protein DOF3.6-like isoform X1 | ||||
TrEMBL | A0A2H3X7N2 | 4e-55 | A0A2H3X7N2_PHODC; dof zinc finger protein DOF5.1-like isoform X2 | ||||
STRING | XP_008779546.1 | 7e-56 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP140 | 37 | 367 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G55370.1 | 6e-44 | OBF-binding protein 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aco001456.1 |