PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aco001114.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 110aa MW: 11775.4 Da PI: 7.5903 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 103.2 | 1.8e-32 | 43 | 100 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 vrY eC+kNhAas+GghavDGC+Efm+ geegt+ al+CaACgCHR+FHRr +e+e Aco001114.1 43 VVRYGECQKNHAASIGGHAVDGCREFMAGAGEEGTSGALTCAACGCHRSFHRRLQEYE 100 69***************************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 9.0E-25 | 42 | 107 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 3.4E-29 | 44 | 97 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 7.5E-27 | 45 | 95 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.52 | 46 | 96 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
MTLLVAEKES SKSIDKMKKC LVVLRGCEPD GRIRCSEACV RRVVRYGECQ KNHAASIGGH 60 AVDGCREFMA GAGEEGTSGA LTCAACGCHR SFHRRLQEYE AACDCSSET* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020111091.1 | 1e-73 | mini zinc finger protein 2-like | ||||
Swissprot | Q9LJW5 | 8e-32 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A199V0Y9 | 3e-72 | A0A199V0Y9_ANACO; Mini zinc finger protein 2 | ||||
STRING | XP_002534013.1 | 2e-32 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1431 | 34 | 120 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 3e-34 | mini zinc finger 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aco001114.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|