PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn390011 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 144aa MW: 16735.9 Da PI: 7.0936 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 28.6 | 2.3e-09 | 89 | 123 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yp+++++ LA+++gL+++q+ +WF N+R ++ Achn390011 89 KWPYPTEADKIFLAESTGLDQKQINNWFINQRKRH 123 569*****************************885 PP | |||||||
2 | ELK | 37.3 | 5.7e-13 | 42 | 63 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK+ LlrKY+g++gsLk EFs Achn390011 42 ELKDTLLRKYGGHIGSLKLEFS 63 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 6.4E-7 | 42 | 63 | IPR005539 | ELK domain |
Pfam | PF03789 | 6.1E-10 | 42 | 63 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 10.458 | 42 | 62 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.86 | 63 | 126 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.18E-20 | 64 | 138 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 3.2E-12 | 65 | 130 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-28 | 68 | 128 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.94E-11 | 75 | 127 | No hit | No description |
Pfam | PF05920 | 3.9E-18 | 83 | 122 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 101 | 124 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MNFNTVSELI LIIADEVAVS SDEEFSGAME VPEARTRSEE QELKDTLLRK YGGHIGSLKL 60 EFSKKKKKKG KLPKDARETL FEWWSSHYKW PYPTEADKIF LAESTGLDQK QINNWFINQR 120 KRHWKPSANM MENLSGHFFT DDH* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018805223.1 | 2e-56 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Refseq | XP_018805224.1 | 2e-56 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 3e-49 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A2R6QR56 | 3e-76 | A0A2R6QR56_ACTCH; Homeobox protein knotted-1-like | ||||
STRING | VIT_01s0127g00210.t01 | 8e-56 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA753 | 24 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.2 | 1e-43 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|