PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn353281 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 152aa MW: 17355.4 Da PI: 9.8741 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.3 | 1.3e-32 | 72 | 130 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+ Achn353281 72 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCHVKKQVQRLSKDEGVVVTTYEGIHSHP 130 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.1E-33 | 57 | 130 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 9.68E-30 | 64 | 131 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.735 | 67 | 132 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.7E-38 | 72 | 131 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.4E-26 | 73 | 130 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MVNSHAYNDS FQGDKADGYC NMGVPNFSDV SQSQSFVGTE STNEVKSGKK KGEKKVRKPK 60 YAFQTRSQVD ILDDGYRWRK YGQKAVKNNK FPRSYYRCTH QGCHVKKQVQ RLSKDEGVVV 120 TTYEGIHSHP INKSTDNFEH ILTQMQIYTA F* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 8e-28 | 62 | 131 | 7 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 8e-28 | 62 | 131 | 7 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028124928.1 | 2e-81 | probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 5e-56 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A2R6REK2 | 1e-109 | A0A2R6REK2_ACTCH; WRKY transcription factor | ||||
STRING | POPTR_0003s16750.1 | 9e-73 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2204 | 24 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 7e-58 | WRKY DNA-binding protein 75 |