PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn310001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | ERF | ||||||||
Protein Properties | Length: 160aa MW: 18121.3 Da PI: 8.343 | ||||||||
Description | ERF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | AP2 | 50.8 | 4e-16 | 7 | 57 | 2 | 54 |
AP2 2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkle 54 +y+GVr+++ +g+W + + + n +++r++lg+f tae+Aa+a+++a++ + Achn310001 7 RYRGVRQRH-WGSWKCFLNLFDAN-RKTRIWLGTFETAEDAARAYDEAARLMC 57 69******9.*******7775333.47**********************8775 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd00018 | 6.28E-26 | 6 | 68 | No hit | No description |
Pfam | PF00847 | 4.2E-12 | 7 | 58 | IPR001471 | AP2/ERF domain |
SuperFamily | SSF54171 | 1.37E-17 | 7 | 68 | IPR016177 | DNA-binding domain |
PROSITE profile | PS51032 | 18.439 | 7 | 66 | IPR001471 | AP2/ERF domain |
Gene3D | G3DSA:3.30.730.10 | 5.3E-28 | 7 | 67 | IPR001471 | AP2/ERF domain |
SMART | SM00380 | 1.1E-26 | 7 | 72 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 2.4E-11 | 8 | 19 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 2.4E-11 | 32 | 48 | IPR001471 | AP2/ERF domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MARSQQRYRG VRQRHWGSWK CFLNLFDANR KTRIWLGTFE TAEDAARAYD EAARLMCGPR 60 TRTNFPYNAI EAQSSSSKIL SAALTAKLQR CHMTSQQVSK KTKTKEPHPH DAQSHHVLGN 120 EGQAGSEQQF KALEDDHIEQ MIEELLDYGS IELCSVVPN* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021276846.1 | 5e-67 | ethylene-responsive transcription factor ERF003-like | ||||
Swissprot | Q94AW5 | 7e-60 | ERF03_ARATH; Ethylene-responsive transcription factor ERF003 | ||||
TrEMBL | A0A2R6QG43 | 1e-105 | A0A2R6QG43_ACTCH; Ethylene-responsive transcription factor | ||||
STRING | EOY29376 | 2e-65 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1362 | 24 | 76 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G25190.1 | 6e-50 | ERF family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|