PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn310001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ERF
Protein Properties Length: 160aa    MW: 18121.3 Da    PI: 8.343
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn310001genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP250.84e-16757254
         AP2  2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkle 54
                +y+GVr+++ +g+W + +  +  n +++r++lg+f tae+Aa+a+++a++ + 
  Achn310001  7 RYRGVRQRH-WGSWKCFLNLFDAN-RKTRIWLGTFETAEDAARAYDEAARLMC 57
                69******9.*******7775333.47**********************8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000186.28E-26668No hitNo description
PfamPF008474.2E-12758IPR001471AP2/ERF domain
SuperFamilySSF541711.37E-17768IPR016177DNA-binding domain
PROSITE profilePS5103218.439766IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.105.3E-28767IPR001471AP2/ERF domain
SMARTSM003801.1E-26772IPR001471AP2/ERF domain
PRINTSPR003672.4E-11819IPR001471AP2/ERF domain
PRINTSPR003672.4E-113248IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MARSQQRYRG VRQRHWGSWK CFLNLFDANR KTRIWLGTFE TAEDAARAYD EAARLMCGPR  60
TRTNFPYNAI EAQSSSSKIL SAALTAKLQR CHMTSQQVSK KTKTKEPHPH DAQSHHVLGN  120
EGQAGSEQQF KALEDDHIEQ MIEELLDYGS IELCSVVPN*
Functional Description ? help Back to Top
Source Description
UniProtProbably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021276846.15e-67ethylene-responsive transcription factor ERF003-like
SwissprotQ94AW57e-60ERF03_ARATH; Ethylene-responsive transcription factor ERF003
TrEMBLA0A2R6QG431e-105A0A2R6QG43_ACTCH; Ethylene-responsive transcription factor
STRINGEOY293762e-65(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13622476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25190.16e-50ERF family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]