PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn285901 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 85aa MW: 9383.69 Da PI: 5.0756 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 83.6 | 2.2e-26 | 4 | 70 | 32 | 98 |
NF-YC 32 adedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 +++dvkmis eaP+++skacelfi +lt rsw a ++krrtl+k dia+a+ td fdfl++ v Achn285901 4 SNDDVKMISGEAPIVFSKACELFIEQLTKRSWAVALQAKRRTLRKDDIASAIIATDLFDFLLNLVSD 70 689***********************************************************98865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 1.1E-14 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 1.4E-23 | 4 | 68 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.33E-20 | 4 | 70 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MKNSNDDVKM ISGEAPIVFS KACELFIEQL TKRSWAVALQ AKRRTLRKDD IASAIIATDL 60 FDFLLNLVSD STGHEDDCHE AISK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 2e-22 | 4 | 69 | 29 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000250, ECO:0000269|PubMed:17322342}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024168596.1 | 2e-37 | nuclear transcription factor Y subunit C-9-like | ||||
Swissprot | Q9FMV5 | 2e-22 | NFYC4_ARATH; Nuclear transcription factor Y subunit C-4 | ||||
TrEMBL | A0A2R6Q8C3 | 2e-54 | A0A2R6Q8C3_ACTCH; Nuclear transcription factor Y subunit C-4 like | ||||
STRING | XP_004300774.1 | 3e-36 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12881 | 17 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63470.2 | 7e-25 | nuclear factor Y, subunit C4 |