PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn235341 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 131aa MW: 15074.2 Da PI: 10.4676 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 107.4 | 7.1e-34 | 51 | 109 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt+ gC+vkk+v+r+++d+ vv++tYeg Hnh+ Achn235341 51 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHLGCNVKKQVQRQSKDEGVVITTYEGVHNHP 109 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.0E-35 | 36 | 109 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.66E-30 | 43 | 110 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.285 | 46 | 111 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.4E-39 | 51 | 110 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.3E-27 | 52 | 109 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
MLVPTSHAQH VSNSGSFVVS GNEEKPGKKK GEKKIRKPRF AFQTRTQVDI LDDGYRWRKY 60 GQKAVKNNKF PRSYYRCTHL GCNVKKQVQR QSKDEGVVIT TYEGVHNHPI QKPTDNFEQI 120 LSQMHMYPPI * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-28 | 41 | 110 | 7 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 3e-28 | 41 | 110 | 7 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028084020.1 | 6e-68 | probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 2e-50 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A2R6P9H3 | 1e-73 | A0A2R6P9H3_ACTCH; WRKY transcription factor | ||||
STRING | XP_008222197.1 | 8e-62 | (Prunus mume) | ||||
STRING | VIT_17s0000g01280.t01 | 6e-62 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2204 | 24 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 1e-51 | WRKY DNA-binding protein 75 |