PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Achn214461

Organism

Actinidia chinensis

Taxonomic ID

3625

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia

Family

M-type_MADS

Protein Properties

Length: 93aa MW: 10599.2 Da PI: 11.2077

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Achn214461	genome	IKGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	101.9	2.3e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyeys+ Achn214461 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYSN 59 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.1E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.782	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	8.37E-31	2	75	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.82E-39	2	60	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-33	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.7E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-33	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 93 aa Download sequence Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFST RGRLYEYSNN 60 RSFRSRGQGE RVRQLPTNGR VLSIWVMGTN SC*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	6e-21	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_Q	6e-21	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_R	6e-21	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_S	6e-21	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_A	6e-21	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_B	6e-21	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_C	6e-21	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_D	6e-21	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_E	6e-21	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_F	6e-21	1	59	1	59	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269\|PubMed:11828031, ECO:0000269\|PubMed:16326928, ECO:0000269\|PubMed:9869408}.
UniProt	Probable transcription factor (Probable). Is required, together with TT16/AGL32 for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). {ECO:0000269\|PubMed:22176531, ECO:0000305}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB627125	2e-53	AB627125.1 Panax ginseng PgMADS5 mRNA for PgMADS protein5, complete cds.
GenBank	Z46612	2e-53	Z46612.1 P.ginseng gag2 mRNA for agamous 2.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001280931.1	8e-37	agamous-like MADS-box protein AGL11
Refseq	XP_009379167.1	9e-37	PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
Refseq	XP_011016424.1	4e-37	PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
Swissprot	Q38836	3e-36	AGL11_ARATH; Agamous-like MADS-box protein AGL11
Swissprot	Q40704	3e-36	MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBL	A0A2H5N444	4e-37	A0A2H5N444_CITUN; Uncharacterized protein
STRING	XP_009379167.1	4e-36	(Pyrus x bretschneideri)
STRING	XP_008378731.1	3e-36	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.2	1e-38	MIKC_MADS family protein

Publications ? help Back to Top
Kyozuka J,Shimamoto K Ectopic expression of OsMADS3, a rice ortholog of AGAMOUS, caused a homeotic transformation of lodicules to stamens in transgenic rice plants. Plant Cell Physiol., 2002. 43(1): p. 130-5 [PMID:11828031] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Ezquer I, et al. The Developmental Regulator SEEDSTICK Controls Structural and Mechanical Properties of the Arabidopsis Seed Coat. Plant Cell, 2016. 28(10): p. 2478-2492 [PMID:27624758]