PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn212251
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB
Protein Properties Length: 274aa    MW: 30842.7 Da    PI: 9.3787
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn212251genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.23.2e-072565341
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqck 41
                     +WT+eE +++ +a + +  +   +W ++a++++ g++  ++ 
       Achn212251 25 KWTKEENKKFERALAIYDEKtpdRWLRVAAMIP-GKSVSDVL 65
                     8********************************.**998875 PP

2Myb_DNA-binding41.23.8e-13125169347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ +++ + +++G+g+W+ I+r +   +t+ q+ s+ qky
       Achn212251 125 PWTEDEHRRFLMGLQKHGKGDWRNISRNFVISKTPTQVASHAQKY 169
                      8*****************************789***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.9972176IPR017884SANT domain
SMARTSM007171.2E-82274IPR001005SANT/Myb domain
SuperFamilySSF466896.32E-112477IPR009057Homeodomain-like
CDDcd001671.57E-72571No hitNo description
PfamPF002495.2E-62566IPR001005SANT/Myb domain
PROSITE profilePS5129416.667118174IPR017930Myb domain
SuperFamilySSF466897.9E-16121175IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-11122169IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-17122173IPR006447Myb domain, plants
SMARTSM007174.6E-11122172IPR001005SANT/Myb domain
CDDcd001671.54E-9125170No hitNo description
PfamPF002492.6E-11125169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MEFLYPPSYY PNLNLLMQES FSSTKWTKEE NKKFERALAI YDEKTPDRWL RVAAMIPGKS  60
VSDVLRQYVE LESDVSDIEA GLVPIPGYLA SSFTLEIGDD NGFYPFRKGS LLGRASDQEG  120
RKGVPWTEDE HRRFLMGLQK HGKGDWRNIS RNFVISKTPT QVASHAQKYF MRQNSSEKDK  180
RRPSINDITT IHLTHTDSSV KANRESPSLD KSNQNQANGG ATMVFDSNPS EIAKNGLKLQ  240
RGARLGTHVG LPLSSSQIQY TRYDLGQCLS LMS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A9e-152288773RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028072700.11e-115transcription factor DIVARICATA-like
SwissprotQ8S9H71e-83DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A2R6RWU10.0A0A2R6RWU1_ACTCH; Transcription factor DIVARICATA like
STRINGEMJ204611e-101(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.15e-85MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]