PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn202121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB
Protein Properties Length: 391aa    MW: 44339.7 Da    PI: 5.3676
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn202121genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.2e-17159205148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd ll+++v+++G + W+ Ia+++  gR +kqc++rw+++l
       Achn202121 159 KGQWTIEEDRLLIHLVEKYGVRKWSHIAQMLK-GRIGKQCRERWHNHL 205
                      799****************************9.*************97 PP

2Myb_DNA-binding52.79.6e-17211253145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd  l++a+ + G++ W+ Ia++++ gRt++++k++w+
       Achn202121 211 KDTWSEEEDRVLIQAHLEVGNK-WAEIAKRLP-GRTENSIKNHWN 253
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.556154209IPR017930Myb domain
SuperFamilySSF466891.59E-31157252IPR009057Homeodomain-like
SMARTSM007171.3E-15158207IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-27160212IPR009057Homeodomain-like
PfamPF139211.6E-18162219No hitNo description
CDDcd001673.46E-14162205No hitNo description
PROSITE profilePS5129421.855210260IPR017930Myb domain
SMARTSM007172.2E-16210258IPR001005SANT/Myb domain
CDDcd001671.04E-11213256No hitNo description
Gene3DG3DSA:1.10.10.603.6E-22213258IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MELDNKFRED LNFQQQRPPL LLPNNYLKPE IEEDGFCFES CQSKNFFQDF DDHFSFTGSS  60
LNSETACLDP FDPFANISSL NFDDFYESKP FDECGDNGGG GGNCVVFNCE DAKPVSFMIP  120
DEGSCVTAEN GYYKEGGGGK KNGHTRKQGK GRKKSNSVKG QWTIEEDRLL IHLVEKYGVR  180
KWSHIAQMLK GRIGKQCRER WHNHLRPDIK KDTWSEEEDR VLIQAHLEVG NKWAEIAKRL  240
PGRTENSIKN HWNATKRRQY SRRKCRTKFP RPSSLLQNYI KSLNLDRPKS TTNPPPPPPP  300
PPPPAAAAAA AADFDRLVPD FDLEVPGWDN LFEESGSIVE SLLDHIHMPN CDEKGFDMSL  360
DLDCSFMEEG SGGEVKKEMD LVEMITQVNL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-481582593104C-Myb DNA-Binding Domain
1msf_C9e-481582593104C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028059763.11e-146transcription factor MYB98-like
SwissprotQ9S7L29e-85MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A438F0A51e-131A0A438F0A5_VITVI; Transcription factor MYB98
STRINGVIT_17s0000g08550.t011e-132(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-83myb domain protein 98
Publications ? help Back to Top
  1. Mendes MA, et al.
    Live and let die: a REM complex promotes fertilization through synergid cell death in Arabidopsis.
    Development, 2016. 143(15): p. 2780-90
    [PMID:27338615]