PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn171711 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 244aa MW: 27106.8 Da PI: 8.0912 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.2 | 9.2e-28 | 45 | 94 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +i+n + rqvtfskRr g++KKAeELSvLCda+va+iifsstgkl+ yss Achn171711 45 KINNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFHYSS 94 699*********************************************96 PP | |||||||
2 | K-box | 44.9 | 5e-16 | 126 | 199 | 18 | 91 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 + ++++L ke+ + +++R++ Ge+L+ L+++eLqqLe+ Le +l ++ +kK e ++++i +lq+k e+ ++ Achn171711 126 NSNYTRLSKEVVEKSHQLRKMRGEELQGLNIEELQQLERSLEAGLGRVIEKKGEKIMNEITHLQQKVMEACKAR 199 46789999999999999*************************************************99987665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.534 | 36 | 96 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.3E-38 | 36 | 95 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.07E-38 | 37 | 112 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 38 | 92 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.5E-26 | 38 | 58 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.07E-30 | 38 | 114 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.8E-26 | 45 | 92 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.5E-26 | 58 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.5E-26 | 73 | 94 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.044 | 122 | 216 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.0E-12 | 126 | 199 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009266 | Biological Process | response to temperature stimulus | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MIGVKVGQTN WKMGEAGVDE GEGSGGLAMI GVKIEMAREK IKIRKINNAT ARQVTFSKRR 60 RGLFKKAEEL SVLCDADVAL IIFSSTGKLF HYSSSDMKGI LERHNVHSKN LEKLEQPSTE 120 LQLVENSNYT RLSKEVVEKS HQLRKMRGEE LQGLNIEELQ QLERSLEAGL GRVIEKKGEK 180 IMNEITHLQQ KVMEACKARK HSATDSDNVI NEQGQSSESV TNICNSTGPM QDYESSDTSL 240 KLG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-21 | 36 | 104 | 1 | 69 | MEF2C |
5f28_B | 4e-21 | 36 | 104 | 1 | 69 | MEF2C |
5f28_C | 4e-21 | 36 | 104 | 1 | 69 | MEF2C |
5f28_D | 4e-21 | 36 | 104 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00272 | DAP | Transfer from AT2G22540 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF838216 | 0.0 | JF838216.1 Actinidia chinensis SVP1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021631111.1 | 1e-116 | MADS-box protein SVP | ||||
Swissprot | Q9FUY6 | 6e-99 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | A0A2R6R641 | 1e-145 | A0A2R6R641_ACTCH; MADS-box protein like | ||||
STRING | cassava4.1_015543m | 1e-116 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA938 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 6e-99 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|