PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn142571
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family GRAS
Protein Properties Length: 504aa    MW: 55771.1 Da    PI: 6.0638
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn142571genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS416.32.7e-1271335031374
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 +++lL++cA a+s++d+  a++l++ l  ++s +g+p+qRl ay++e+L+arl+ s+s +y++l+++e +   sse +++++++++++P++kf++  aN
  Achn142571 133 MKQLLISCAAALSDEDFPTAKRLMEVLVSMVSVSGEPIQRLGAYMLEGLRARLYASGSLIYNKLKCKEPT---SSELMSYMHVLYQICPYYKFAYNSAN 228
                 579******************************************************************9...99************************ PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                   I ea+++e+r+HiiDf+i qG QW++L++ L +Rp+gpp +R+Tgv++p+s   +   l  +g+rL+k+A+++gvpfef+  +a +  ++e+e+Lrv
  Achn142571 229 VVIWEAMANESRIHIIDFQIAQGSQWVSLIEVLGKRPGGPPYIRVTGVDDPQSIhaRGGGLDLVGQRLSKVAASCGVPFEFHG-AAISGCEVEVENLRV 326
                 ****************************************************99889999***********************.888999********* PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                 ++gEalaVn+ + lh+++desv+++++rd++L+lvksls+kvvv+veqe+++n+++Fl rf e+++yysa+f+s++a  pr++++ri+ E+++++r+iv
  Achn142571 327 RHGEALAVNFPYVLHHMPDESVTTRNHRDRLLRLVKSLSAKVVVLVEQESNTNTAPFLPRFKETFDYYSAMFESIDAARPRDDKQRISAEQQCVARDIV 425
                 *************************************************************************************************** PP

        GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 n++aceg+er+erhe ++kWr+rl++aGF+p pls+++   ++ +l+ ++++ yrv e++g+l lgWk+r + + SaWr
  Achn142571 426 NMIACEGEERVERHELFGKWRSRLMMAGFTPCPLSSSVSIAVREVLKDYSKN-YRVVERDGALHLGWKNRVMSTSSAWR 503
                 **************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.444107484IPR005202Transcription factor GRAS
PfamPF035149.4E-125133503IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MCPDNGSQAT HVSFQSYNEQ YFTLDSSPAT GCVAYDTPSA GSISSNITPF SPQGSQSYLS  60
DPRHSSDNTY GSPDSGSSGV DDGSELKHML RVLEFQLLGP ESDVDDSCCS FKGAVDQAYS  120
SMSSCQVMEK LDMKQLLISC AAALSDEDFP TAKRLMEVLV SMVSVSGEPI QRLGAYMLEG  180
LRARLYASGS LIYNKLKCKE PTSSELMSYM HVLYQICPYY KFAYNSANVV IWEAMANESR  240
IHIIDFQIAQ GSQWVSLIEV LGKRPGGPPY IRVTGVDDPQ SIHARGGGLD LVGQRLSKVA  300
ASCGVPFEFH GAAISGCEVE VENLRVRHGE ALAVNFPYVL HHMPDESVTT RNHRDRLLRL  360
VKSLSAKVVV LVEQESNTNT APFLPRFKET FDYYSAMFES IDAARPRDDK QRISAEQQCV  420
ARDIVNMIAC EGEERVERHE LFGKWRSRLM MAGFTPCPLS SSVSIAVREV LKDYSKNYRV  480
VERDGALHLG WKNRVMSTSS AWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-5714050226378Protein SCARECROW
5b3h_A5e-5714050225377Protein SCARECROW
5b3h_D5e-5714050225377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028068208.10.0scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A2R6QM200.0A0A2R6QM20_ACTCH; Scarecrow-like protein
STRINGXP_009773976.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13