PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn112511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family GRAS
Protein Properties Length: 471aa    MW: 52650.7 Da    PI: 6.248
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn112511genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4362.7e-133464651374
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL++cA+ v++g+ e+a+  L+++s+laspdgd+mqR+aayfteALa r+++ +++l kal++++ s  ++see+ a++lf++++P+l++s++++N
  Achn112511  46 LIQLLVACANQVAAGSVEKANIGLEQISHLASPDGDTMQRIAAYFTEALADRMLKGWPGLHKALNSTKIS--SVSEEILAQRLFFDLCPFLRLSYVITN 142
                 689*************************************************************999998..6************************** PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                  aI ea+ege+ vHiiD+   +++QW+ LlqaL++Rpegpp+l+iTg+++    +ke le +++rL++ A +l++pf+fn+ ++++le+l++e Lrvk+
  Achn112511 143 LAIIEAMEGEKVVHIIDLHSFEPAQWIDLLQALSARPEGPPHLKITGIHE----QKEVLELMAHRLNEEAGKLDIPFQFNP-IVSKLENLDIECLRVKT 236
                 **************************************************....9**************************.7999************* PP

        GRAS 199 gEalaVnlvlqlhrll..........................................................desvsleserdevLklvkslsPkvv 239
                 gEala+++vlqlh++l                                                          ++s +      ++Lk++++lsPk++
  Achn112511 237 GEALAISSVLQLHSVLafddemlrrqspsaskslnsvpiqrvfqmssltlgdflekdvvngyspcidspspvsfASSPK----MGNFLKALRGLSPKLM 331
                 ******************************************************************9977655555555....555************* PP

        GRAS 240 vvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                 vv+eqe++hn++s+++r++eal++y+alfd+le+++pr s er+kvE+ l+g+ei+n++aceg er+erhe+lekW  rle aGF+ vpls++   qa 
  Achn112511 332 VVTEQESNHNAHSLMDRVTEALNFYAALFDCLESTVPR-SIERQKVEKLLFGEEIKNIIACEGLERKERHERLEKWIPRLELAGFGRVPLSYHGILQAT 429
                 ***********************************966.789********************************************************* PP

        GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 +ll+ ++ dgyr++ee+g+lv+ W++ pL+s+SaWr
  Achn112511 430 RLLQSYGCDGYRIKEEKGCLVIFWQTTPLFSISAWR 465
                 ***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.90420445IPR005202Transcription factor GRAS
PfamPF035149.4E-13146465IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MVQEEGSSSV NSSPLQLFSL MSLSPGLGSP YPWLRELKSE ERGLCLIQLL VACANQVAAG  60
SVEKANIGLE QISHLASPDG DTMQRIAAYF TEALADRMLK GWPGLHKALN STKISSVSEE  120
ILAQRLFFDL CPFLRLSYVI TNLAIIEAME GEKVVHIIDL HSFEPAQWID LLQALSARPE  180
GPPHLKITGI HEQKEVLELM AHRLNEEAGK LDIPFQFNPI VSKLENLDIE CLRVKTGEAL  240
AISSVLQLHS VLAFDDEMLR RQSPSASKSL NSVPIQRVFQ MSSLTLGDFL EKDVVNGYSP  300
CIDSPSPVSF ASSPKMGNFL KALRGLSPKL MVVTEQESNH NAHSLMDRVT EALNFYAALF  360
DCLESTVPRS IERQKVEKLL FGEEIKNIIA CEGLERKERH ERLEKWIPRL ELAGFGRVPL  420
SYHGILQATR LLQSYGCDGY RIKEEKGCLV IFWQTTPLFS ISAWRFRRYS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-48304672380Protein SCARECROW
5b3h_D1e-48304672380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028108526.10.0scarecrow-like protein 3 isoform X1
RefseqXP_028108527.10.0scarecrow-like protein 3 isoform X2
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A2R6RA360.0A0A2R6RA36_ACTCH; Scarecrow-like protein
STRINGVIT_13s0019g01220.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]