PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn102731
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB
Protein Properties Length: 321aa    MW: 36879.8 Da    PI: 4.9082
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn102731genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.61.7e-1966113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+WT eEd+ lv++++++G g+W++ ar+ g++Rt+k+c++rw++yl
       Achn102731  66 RGPWTVEEDLTLVNYIEKHGDGRWNSLARCAGLKRTGKSCRLRWLNYL 113
                      89********************************************97 PP

2Myb_DNA-binding51.72e-16119162146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ q+G++ W++I+++++ gRt++++k++w++
       Achn102731 119 RGNITLEEQLLILELHSQWGNR-WSKISQHLP-GRTDNEIKNYWRT 162
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.18661117IPR017930Myb domain
SuperFamilySSF466891.33E-3163160IPR009057Homeodomain-like
SMARTSM007175.1E-1665115IPR001005SANT/Myb domain
PfamPF002491.7E-1766113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2367120IPR009057Homeodomain-like
CDDcd001674.59E-1268113No hitNo description
PROSITE profilePS5129418.526118168IPR017930Myb domain
SMARTSM007171.2E-14118166IPR001005SANT/Myb domain
PfamPF002491.1E-14119162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-22121167IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MFASASLVAE EDGDKDFPFR SDSELRSDKY KFVESNKEPP IGKMEVEGRV CDPMSEEERT  60
MMDLRRGPWT VEEDLTLVNY IEKHGDGRWN SLARCAGLKR TGKSCRLRWL NYLRPDVRRG  120
NITLEEQLLI LELHSQWGNR WSKISQHLPG RTDNEIKNYW RTRVQKHAKH LKCDVNSKQF  180
KDTMRYLWMP RLVERIQAHA VAANATDTQT APPLAAVDNL SAAASSSDSF AAQVSPSSDI  240
TDYYNYPVNN NNNAAVISQN QDYDQVNQVF NPDSLTGQWF EAGDFNYGLD FNSQWFEAGD  300
TSDNLWNSDD IWFLQQQFNL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24631664106B-MYB
1h8a_C1e-246316624126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028115735.11e-134transcription factor MYB108-like
TrEMBLA0A2R6PJI51e-170A0A2R6PJI5_ACTCH; Transcription factor like
STRINGPOPTR_0010s15970.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.12e-83myb domain protein 78