PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn085531
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family GRAS
Protein Properties Length: 690aa    MW: 76758.2 Da    PI: 6.8408
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn085531genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS465.43.3e-1422966861374
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lLl+cA++v++g+le+a+ +L ++s+laspdgd+mqR+a+yf eALa+r++++++++ykal++++ s   +see+ ++klf+e +P+lk++++++N
  Achn085531 296 LIHLLLACANHVATGSLENANITLDQISQLASPDGDTMQRIASYFNEALAERILKNWPGIYKALHSTRIS--LVSEEILVRKLFYESFPFLKVAFVITN 392
                 689*************************************************************999887..7************************** PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 qaI ea+ege++vHiiD+++ +++QW aLlq L++Rpegpp+lRiTgv++    +ke le++++ L++ Ae+l++pf+fn  ++++led+++e+Lrvk+
  Achn085531 393 QAIIEAMEGEKMVHIIDLNAAEPAQWRALLQDLSARPEGPPHLRITGVHQ----KKEVLEQMAHILTEEAEKLDIPFQFNQ-IVSKLEDIDIEKLRVKT 486
                 **************************************************....9**************************.7999************* PP

        GRAS 199 gEalaVnlvlqlhrll.......................desvsles.erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                 gEala+++vlqlh+ll                       ++s+++++ +  ++L+++++lsPkv+vv+eq+++hn+++++er++e+l++y+alfd+le+
  Achn085531 487 GEALAISSVLQLHTLLanddellrkkslvtpknanglnlQRSLQMNQgTLGDFLNALWGLSPKVMVVMEQDSNHNGSTLMERLSESLYFYAALFDCLES 585
                 ***************************************8888888878899*********************************************** PP

        GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                 +lpr+s er kvE++l+g+ei+n+++ceg+er+ rhe+lekW +rl+ aGF++vpls++ + qa++ll+ ++ dgyr++ee+g+++ +W+dr+L+svSa
  Achn085531 586 TLPRTSLERLKVEKMLFGEEIKNIISCEGSERKRRHEKLEKWIQRLDLAGFGSVPLSYYSVLQARRLLQSYSCDGYRIKEENGCVMVYWQDRALFSVSA 684
                 *************************************************************************************************** PP

        GRAS 373 Wr 374
                 Wr
  Achn085531 685 WR 686
                 *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1105811.31E-5119236No hitNo description
PfamPF042277.5E-5767234IPR007342Pseudouridine-5'-phosphate glycosidase
PROSITE profilePS5098559.562270666IPR005202Transcription factor GRAS
PfamPF035141.1E-139296686IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016798Molecular Functionhydrolase activity, acting on glycosyl bonds
Sequence ? help Back to Top
Protein Sequence    Length: 690 aa     Download sequence    Send to blast
MGTTVGYGVW ISSSTTSCLS AEELERLANL GTKSRKTARR DIAHVVSKTQ TISLFMKVID  60
YHIVFMTMDI SSDLTELGRT PIAVISAGVK SILDIPRTLE YLETQGVCVA AYKTDEFPAF  120
FTETSGYKPQ KEKGEEETKA NANMKLKLGT GILIAVPIPK EYSASGSLIE SAIQRALKEA  180
RDKGVTGNAE TPFLLARVNE LTGGASLSSS ILSLDAQNIA LVKNNALVGA KIAVSLAQMR  240
EGDHRVSYSQ MFQDDGSSSV TSSPLKAFPM MSVSPGFGSP YPWLRELKSE ERGLYLIHLL  300
LACANHVATG SLENANITLD QISQLASPDG DTMQRIASYF NEALAERILK NWPGIYKALH  360
STRISLVSEE ILVRKLFYES FPFLKVAFVI TNQAIIEAME GEKMVHIIDL NAAEPAQWRA  420
LLQDLSARPE GPPHLRITGV HQKKEVLEQM AHILTEEAEK LDIPFQFNQI VSKLEDIDIE  480
KLRVKTGEAL AISSVLQLHT LLANDDELLR KKSLVTPKNA NGLNLQRSLQ MNQGTLGDFL  540
NALWGLSPKV MVVMEQDSNH NGSTLMERLS ESLYFYAALF DCLESTLPRT SLERLKVEKM  600
LFGEEIKNII SCEGSERKRR HEKLEKWIQR LDLAGFGSVP LSYYSVLQAR RLLQSYSCDG  660
YRIKEENGCV MVYWQDRALF SVSAWRCRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-672806882380Protein SCARECROW
5b3h_D1e-672806882380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028094205.10.0scarecrow-like protein 3
RefseqXP_028094206.10.0scarecrow-like protein 3
RefseqXP_028106666.10.0scarecrow-like protein 3
RefseqXP_028106667.10.0scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A2R6P8290.0A0A2R6P829_ACTCH; Scarecrow-like protein
STRINGEOY328060.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]