PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn035581
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB
Protein Properties Length: 511aa    MW: 57758.9 Da    PI: 6.7639
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn035581genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-17449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+++G+++W++Ia++++ gR++k+c++rw++ 
       Achn035581  4 RGHWRPAEDEKLRELVERYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding51.62.2e-165899346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     ++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
       Achn035581 58 PFTEEEEERLLASHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 99
                     89******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.07154IPR017930Myb domain
SMARTSM007172.9E-15352IPR001005SANT/Myb domain
PfamPF002492.5E-17449IPR001005SANT/Myb domain
SuperFamilySSF466892.91E-29497IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-26557IPR009057Homeodomain-like
CDDcd001674.84E-14748No hitNo description
SMARTSM007171.1E-1455103IPR001005SANT/Myb domain
PROSITE profilePS5129420.2955105IPR017930Myb domain
PfamPF002493.1E-135898IPR001005SANT/Myb domain
CDDcd001671.06E-115898No hitNo description
Gene3DG3DSA:1.10.10.602.8E-1958104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MCTRGHWRPA EDEKLRELVE RYGPHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINGSPFT  60
EEEEERLLAS HRIHGNRWAI IARLFPGRTD NAVKNHWHVI MARRCRERSR VFAKRAAQTL  120
KRHDVHVQIN CEMNNFAAFA DRSCASFEYP STLVHYPIFK DLYCRDRIPH MKIHEDDHRK  180
QAVEFYDFLQ VNADSNRSEL TENVINVRRS DQEEEEEVEQ EPNNQQIKAA NLRSPVSDLT  240
QKPRSSGINE TFAISTTTEA AAEEPAAAAP DSLFPVAFRP ASNGDAITNA HPRQWLCNQS  300
FITDLSVIED AVKHTNPMVE SQSEEEEEEE GIKIEDKYTR LQSYELVKAS SDGERGRRRR  360
RDLILPLLHA QPTILMPPPG SRTFHLGIVR LLTPPSPPPK TITSIPMEIA TISPSDAFTV  420
KLHAINPSSF CSSTTSRGSI VAYATALKSW AVSLWVTWQS SSLTESSGFH SSGTETEMEG  480
ESADRAHACL ATPFAGRTHI FALPLVFFPL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-3141047107B-MYB
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7112879e-97KP711287.1 Betula platyphylla MYB transcription factor 3 (MYB3) mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-77myb domain protein 52