PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn029591 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 213aa MW: 24232.8 Da PI: 6.5159 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 25.2 | 3.8e-08 | 23 | 66 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44 +WT Ed+ + +a ++ + +Wk Ia +++ g+++++++ ++ Achn029591 23 AWTRFEDKVFEHALVVFPEEgpdRWKNIADRLP-GKSPEEVRAHY 66 7*****************999************.**********9 PP | |||||||
2 | Myb_DNA-binding | 42.3 | 1.7e-13 | 118 | 162 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + + +G g+W++I+r + +Rt+ q+ s+ qky Achn029591 118 PWTEEEHRLFLIGLNTYGRGDWRSISRNVVVTRTPTQVASHAQKY 162 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.79E-11 | 10 | 82 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 8.012 | 16 | 74 | IPR017930 | Myb domain |
SMART | SM00717 | 7.5E-7 | 20 | 72 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.03E-7 | 23 | 70 | No hit | No description |
Pfam | PF00249 | 1.5E-6 | 23 | 67 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.6E-6 | 24 | 70 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 17.521 | 111 | 167 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.07E-17 | 113 | 168 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.1E-16 | 114 | 166 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 9.1E-11 | 115 | 161 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.3E-11 | 115 | 165 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.93E-9 | 118 | 162 | No hit | No description |
Pfam | PF00249 | 1.8E-11 | 118 | 162 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 213 aa Download sequence Send to blast |
MYGDDGSDYR WSMIGNSSAT QSAWTRFEDK VFEHALVVFP EEGPDRWKNI ADRLPGKSPE 60 EVRAHYEALV HDVLEIDSGR VELPSYSDES ALGWETDSTQ ISFCKNRHGE VDRKKGTPWT 120 EEEHRLFLIG LNTYGRGDWR SISRNVVVTR TPTQVASHAQ KYYLRQNSVK KDRKRSSIHD 180 ITTTADTLVI PPPAHFPNQG GSIGYQNFNY PM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 3e-16 | 14 | 86 | 1 | 73 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00055 | PBM | Transfer from AT5G04760 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028088296.1 | 1e-117 | transcription factor SRM1-like | ||||
Swissprot | Q9FNN6 | 1e-54 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A2R6PW85 | 1e-155 | A0A2R6PW85_ACTCH; Transcription factor DIVARICATA like (Fragment) | ||||
STRING | XP_008231910.1 | 6e-96 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4547 | 22 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 5e-78 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|