PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn013391 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 208aa MW: 23282.2 Da PI: 9.6942 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.3 | 1.3e-16 | 15 | 60 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+W++ Ed l ++v q+G+ +W++I++ ++ gR++k+c++rw++ Achn013391 15 RGSWSPAEDATLMRLVDQHGPCNWAAISNGIQ-GRSGKSCRLRWLNQ 60 89******************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 53.2 | 6.7e-17 | 68 | 111 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +++++ Ed ++++a++ +G++ W+tIar ++ gRt++ +k++w++ Achn013391 68 NPFSPAEDAIILKAHEVYGNR-WATIARQLP-GRTDNAIKNHWNST 111 689******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.481 | 10 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.63E-29 | 13 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.9E-12 | 14 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.7E-17 | 15 | 60 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-22 | 16 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.32E-11 | 17 | 59 | No hit | No description |
PROSITE profile | PS51294 | 23.271 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 5.5E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.9E-14 | 68 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.22E-12 | 69 | 112 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.2E-22 | 69 | 115 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
MEEIPVAESG GDRVRGSWSP AEDATLMRLV DQHGPCNWAA ISNGIQGRSG KSCRLRWLNQ 60 LSPAVEHNPF SPAEDAIILK AHEVYGNRWA TIARQLPGRT DNAIKNHWNS TLSRRCKAES 120 NSANSVTTES DSGAKRRRFG ENAEEEGPKT SLTLTLSPPG ERVGLRREEV RIKRDDERLM 180 NVIRRMIAEE VRRYIDRVLV AEKIKSI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-34 | 12 | 116 | 4 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028091194.1 | 1e-81 | transcription factor MYB77-like | ||||
Swissprot | Q9SN12 | 1e-47 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A2R6PLL0 | 1e-147 | A0A2R6PLL0_ACTCH; Transcription factor like | ||||
STRING | XP_010253806.1 | 3e-73 | (Nelumbo nucifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12883 | 16 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 3e-50 | myb domain protein 77 |
Publications ? help Back to Top | |||
---|---|---|---|
|