PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn012501
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family GRAS
Protein Properties Length: 472aa    MW: 53255.1 Da    PI: 6.0371
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn012501genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS466.91.2e-142464681374
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lLl+cA+ v++g+le+a+ +L ++s+laspdgd+mqR+a+yfteALa+r++++++++ykal++++ s   +see+ ++klf+e +P+lk++++++N
  Achn012501  46 LIHLLLACANYVATGSLENANITLDQISQLASPDGDTMQRIASYFTEALAERILKNWPGIYKALHSTRIS--LVSEEILVRKLFYESFPFLKVAFVITN 142
                 689*************************************************************999887..7************************** PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 qaI ea+ege++vHiiD+++ +++QW aLlq L+sRpegpp+lRiTgv++    +ke le++++ L++ Ae+l++pf+fn  ++++led+++e+Lrvk+
  Achn012501 143 QAIIEAMEGEKMVHIIDLNAAEPAQWRALLQDLSSRPEGPPHLRITGVHQ----KKEVLEQMAHILTEEAEKLDIPFQFNQ-IVSKLEDIDIEKLRVKT 236
                 **************************************************....9**************************.7999************* PP

        GRAS 199 gEalaVnlvlqlhrll......................................................desvsles..erdevLklvkslsPkvvvv 241
                 gEala++lvlqlh+ll                                                      ++s++l+   + d++L+++++lsPkv+ v
  Achn012501 237 GEALAISLVLQLHTLLatddellrkkspvtpknangfnlqrslqmnqgtlgellekdlvngyspshvsasSSSLPLNAslRMDSFLNALWGLSPKVMLV 335
                 ********************************************************************9855555555568899*************** PP

        GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
                 +eq+++hn+++++er++e+l++y+alfd+le++lpr+s er kvE++l+g+ei+n+++cegaer+ rhe+lekW +rl+ aGF++vpls++ + qa++l
  Achn012501 336 TEQDSNHNGSTLMERLSESLYFYAALFDCLESTLPRTSLERLKVEKMLFGEEIKNIISCEGAERKRRHEKLEKWVQRLDLAGFGSVPLSYYSTLQARRL 434
                 *************************************************************************************************** PP

        GRAS 341 lrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 l+ ++ dgyr++ee+g+++++W+dr+L+svSaWr
  Achn012501 435 LQSYSCDGYRINEENGCVMIYWQDRALFSVSAWR 468
                 *********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.7520448IPR005202Transcription factor GRAS
PfamPF035144.0E-14046468IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MFQDDGSSSV TSSPLQAFPM MSLSPGFGSP YPWLRELKSE ERGLYLIHLL LACANYVATG  60
SLENANITLD QISQLASPDG DTMQRIASYF TEALAERILK NWPGIYKALH STRISLVSEE  120
ILVRKLFYES FPFLKVAFVI TNQAIIEAME GEKMVHIIDL NAAEPAQWRA LLQDLSSRPE  180
GPPHLRITGV HQKKEVLEQM AHILTEEAEK LDIPFQFNQI VSKLEDIDIE KLRVKTGEAL  240
AISLVLQLHT LLATDDELLR KKSPVTPKNA NGFNLQRSLQ MNQGTLGELL EKDLVNGYSP  300
SHVSASSSSL PLNASLRMDS FLNALWGLSP KVMLVTEQDS NHNGSTLMER LSESLYFYAA  360
LFDCLESTLP RTSLERLKVE KMLFGEEIKN IISCEGAERK RRHEKLEKWV QRLDLAGFGS  420
VPLSYYSTLQ ARRLLQSYSC DGYRINEENG CVMIYWQDRA LFSVSAWRCR R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-41464684375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028094205.10.0scarecrow-like protein 3
RefseqXP_028094206.10.0scarecrow-like protein 3
RefseqXP_028106666.10.0scarecrow-like protein 3
RefseqXP_028106667.10.0scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A2R6PFT40.0A0A2R6PFT4_ACTCH; Scarecrow-like protein
STRINGEOY328060.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]