PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn002431
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family NF-YC
Protein Properties Length: 85aa    MW: 9260.5 Da    PI: 4.3322
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn002431genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC863.9e-273713199
       NF-YC 31 kadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99
                k+ +dvkmis eaP++++kacelfi elt  sw  + ++krrtl+k d+a+av+ td+fdflv+ v  +
  Achn002431  3 KSSDDVKMISGEAPIVFAKACELFIEELTKSSWTMTLQAKRRTLQKEDVASAVAATDVFDFLVNLVSDS 71
                7899***********************************************************999765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008082.1E-15155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471132.61E-21369IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.6E-25368IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MKKSSDDVKM ISGEAPIVFA KACELFIEEL TKSSWTMTLQ AKRRTLQKED VASAVAATDV  60
FDFLVNLVSD SNTAAEDNSE PMEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_B9e-263682893NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Interacts with REF6 to directly regulate SOC1 transcription in response to flowering signals from photoperiod and gibberellic acid pathways (PubMed:25105952). {ECO:0000250, ECO:0000269|PubMed:25105952}.
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009785550.12e-39PREDICTED: nuclear transcription factor Y subunit C-2-like
RefseqXP_016505996.12e-39PREDICTED: nuclear transcription factor Y subunit C-2-like
SwissprotQ8L4B21e-24NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
SwissprotQ9ZVL37e-25NFYC3_ARATH; Nuclear transcription factor Y subunit C-3
TrEMBLA0A2R6QK984e-52A0A2R6QK98_ACTCH; Nuclear transcription factor Y subunit C-3 like
STRINGXP_009785550.18e-39(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128811720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54830.33e-27nuclear factor Y, subunit C3
Publications ? help Back to Top
  1. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  2. Liu X, et al.
    The NF-YC-RGL2 module integrates GA and ABA signalling to regulate seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12768
    [PMID:27624486]
  3. Myers ZA, et al.
    NUCLEAR FACTOR Y, Subunit C (NF-YC) Transcription Factors Are Positive Regulators of Photomorphogenesis in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(9): p. e1006333
    [PMID:27685091]
  4. Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M
    Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants.
    Mol Plant, 2017. 10(4): p. 645-648
    [PMID:27871811]
  5. Tang Y, et al.
    Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation.
    Mol Plant, 2017. 10(2): p. 260-273
    [PMID:27876642]
  6. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  7. Gnesutta N, et al.
    CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer.
    Plant Cell, 2017. 29(6): p. 1516-1532
    [PMID:28526714]
  8. Bi C,Ma Y,Wang XF,Zhang DP
    Overexpression of the transcription factor NF-YC9 confers abscisic acid hypersensitivity in Arabidopsis.
    Plant Mol. Biol., 2017. 95(4-5): p. 425-439
    [PMID:28924726]
  9. Liu X, et al.
    Temporal-Specific Interaction of NF-YC and CURLY LEAF during the Floral Transition Regulates Flowering.
    Plant Physiol., 2018. 177(1): p. 105-114
    [PMID:29599268]