PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn002431 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 85aa MW: 9260.5 Da PI: 4.3322 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 86 | 3.9e-27 | 3 | 71 | 31 | 99 |
NF-YC 31 kadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 k+ +dvkmis eaP++++kacelfi elt sw + ++krrtl+k d+a+av+ td+fdflv+ v + Achn002431 3 KSSDDVKMISGEAPIVFAKACELFIEELTKSSWTMTLQAKRRTLQKEDVASAVAATDVFDFLVNLVSDS 71 7899***********************************************************999765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 2.1E-15 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 2.61E-21 | 3 | 69 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 1.6E-25 | 3 | 68 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MKKSSDDVKM ISGEAPIVFA KACELFIEEL TKSSWTMTLQ AKRRTLQKED VASAVAATDV 60 FDFLVNLVSD SNTAAEDNSE PMEK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 9e-26 | 3 | 68 | 28 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Interacts with REF6 to directly regulate SOC1 transcription in response to flowering signals from photoperiod and gibberellic acid pathways (PubMed:25105952). {ECO:0000250, ECO:0000269|PubMed:25105952}. | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009785550.1 | 2e-39 | PREDICTED: nuclear transcription factor Y subunit C-2-like | ||||
Refseq | XP_016505996.1 | 2e-39 | PREDICTED: nuclear transcription factor Y subunit C-2-like | ||||
Swissprot | Q8L4B2 | 1e-24 | NFYC9_ARATH; Nuclear transcription factor Y subunit C-9 | ||||
Swissprot | Q9ZVL3 | 7e-25 | NFYC3_ARATH; Nuclear transcription factor Y subunit C-3 | ||||
TrEMBL | A0A2R6QK98 | 4e-52 | A0A2R6QK98_ACTCH; Nuclear transcription factor Y subunit C-3 like | ||||
STRING | XP_009785550.1 | 8e-39 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12881 | 17 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G54830.3 | 3e-27 | nuclear factor Y, subunit C3 |