PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA96G00120 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 157aa MW: 16989.2 Da PI: 4.2685 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 128.4 | 2.5e-40 | 1 | 73 | 30 | 102 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102 +kadedv+misaeaP+l++kacelfilelt+rswlhaeenkrrtl+k+di+aa+trtdifdflvdivprde+k AA96G00120 1 MKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDISAAITRTDIFDFLVDIVPRDEIK 73 9*********************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 1.26E-23 | 1 | 69 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 1.0E-29 | 1 | 69 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.4E-14 | 1 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MKADEDVRMI SAEAPILFAK ACELFILELT IRSWLHAEEN KRRTLQKNDI SAAITRTDIF 60 DFLVDIVPRD EIKDETALGG MVAPTSSGIM PYYYPPIGQP TGPGGMMIGR PAMDPSGVYL 120 QPPSQPWQNV WQTPGTGDDV SYGSGGSSGQ GNIDGQG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 8e-41 | 1 | 69 | 27 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 41 | 47 | RRTLQKN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA96G00120 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB007649 | 2e-70 | AB007649.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MLE2. | |||
GenBank | AK317038 | 2e-70 | AK317038.1 Arabidopsis thaliana AT5G63470 mRNA, complete cds, clone: RAFL19-94-G17. | |||
GenBank | AY072402 | 2e-70 | AY072402.1 Arabidopsis thaliana transcription factor Hap5a-like protein (At5g63470) mRNA, complete cds. | |||
GenBank | BT000218 | 2e-70 | BT000218.1 Arabidopsis thaliana transcription factor Hap5a-like protein (At5g63470) mRNA, complete cds. | |||
GenBank | CP002688 | 2e-70 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010426356.1 | 2e-97 | PREDICTED: nuclear transcription factor Y subunit C-1 isoform X1 | ||||
Refseq | XP_010426357.1 | 2e-97 | PREDICTED: nuclear transcription factor Y subunit C-1 isoform X2 | ||||
Refseq | XP_010515180.1 | 2e-97 | PREDICTED: nuclear transcription factor Y subunit C-1-like isoform X1 | ||||
Refseq | XP_010515181.1 | 2e-97 | PREDICTED: nuclear transcription factor Y subunit C-1-like isoform X2 | ||||
Swissprot | Q9SMP0 | 2e-88 | NFYC1_ARATH; Nuclear transcription factor Y subunit C-1 | ||||
TrEMBL | R0FL35 | 4e-95 | R0FL35_9BRAS; Uncharacterized protein | ||||
STRING | Bostr.18473s0090.1.p | 1e-97 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM478 | 28 | 160 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G48590.1 | 4e-85 | nuclear factor Y, subunit C1 |
Publications ? help Back to Top | |||
---|---|---|---|
|