PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA60G00072 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 169aa MW: 18519.7 Da PI: 8.4647 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 175.5 | 5.3e-55 | 32 | 126 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdrflPian+srimk+ lP n+ki+kdak+tvqecvsefisfvtseasdkcqrekrktingddllwa+atlGfe y+eplk+yl++yre ++ AA60G00072 32 VREQDRFLPIANISRIMKRGLPPNGKIAKDAKDTVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFESYIEPLKIYLMRYREGDT 126 69*****************************************************************************************9665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-52 | 28 | 148 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 8.23E-39 | 35 | 138 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.4E-27 | 38 | 102 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.6E-21 | 66 | 84 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 69 | 85 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.6E-21 | 85 | 103 | No hit | No description |
PRINTS | PR00615 | 2.6E-21 | 104 | 122 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MAESQNKSSG MSPGACGSHE SGGDQSPKSS QVREQDRFLP IANISRIMKR GLPPNGKIAK 60 DAKDTVQECV SEFISFVTSE ASDKCQREKR KTINGDDLLW AMATLGFESY IEPLKIYLMR 120 YREGDTKGSA KGGDMNAKKD VQSSQNGQFS QLAHQGSFSQ DPYGNSQIK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 3e-47 | 33 | 123 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 3e-47 | 33 | 123 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA60G00072 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353083 | 1e-135 | AK353083.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-13-K14. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006410886.1 | 1e-103 | nuclear transcription factor Y subunit B-8 | ||||
Swissprot | Q8VYK4 | 2e-99 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | E4MX36 | 1e-102 | E4MX36_EUTHA; mRNA, clone: RTFL01-13-K14 | ||||
TrEMBL | V4M7P8 | 1e-102 | V4M7P8_EUTSA; Uncharacterized protein | ||||
STRING | Bostr.23794s0383.1.p | 1e-105 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1480 | 27 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 1e-102 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|