PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA53G00004 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 136aa MW: 14701.6 Da PI: 7.0709 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 56.7 | 6.8e-18 | 30 | 81 | 49 | 100 |
DUF260 49 lpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 lp e+r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+a+lal+++e AA53G00004 30 LPMEQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQAQLALAQAE 81 7889*******************************************99976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 9.363 | 1 | 82 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 6.9E-16 | 30 | 79 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MKESSRKQGA ASPCAACKLL RRRCAHDCEL PMEQRGDAVS SMVYEANARV RDPVYGCVGA 60 ISSLQQQIDV LQAQLALAQA EVVHLRVRHS THLSSHVACS DSPSSSGSPP QGNKGMFNNH 120 MDIMDEASLG ESMWSC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-21 | 9 | 83 | 7 | 112 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-21 | 9 | 83 | 7 | 112 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA53G00004 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018486923.1 | 2e-64 | PREDICTED: LOB domain-containing protein 4 | ||||
Swissprot | Q9SHE9 | 2e-58 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
TrEMBL | A0A078INQ1 | 9e-63 | A0A078INQ1_BRANA; BnaCnng19520D protein | ||||
TrEMBL | A0A0D3D5L9 | 9e-63 | A0A0D3D5L9_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6EJ49 | 9e-63 | A0A3P6EJ49_BRAOL; Uncharacterized protein | ||||
STRING | Bo7g041000.1 | 1e-63 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 2e-52 | LOB domain-containing protein 4 |