PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA39G00162 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 227aa MW: 25849.3 Da PI: 9.1979 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.9 | 1.8e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd +l+ ++++G +W++ +++ g+ R++k+c++rw++yl AA39G00162 14 KGEWTAEEDRKLAAFITEHGFADWRSLPKKAGLQRCGKSCRLRWLNYL 61 799*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 56.9 | 4.6e-18 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g++T+eE++ +++ +++lG++ W++Ia++++ +Rt++++k++w++ AA39G00162 67 KGKFTPEEEDVIIQFHALLGNR-WASIAKELP-NRTDNDIKNHWNSC 111 79********************.*********.***********975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.727 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.83E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.3E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.9E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.4E-23 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.70E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 28.088 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 9.8E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.9E-17 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.92E-11 | 69 | 109 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-26 | 69 | 117 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MGRTTWYDVD GKRKGEWTAE EDRKLAAFIT EHGFADWRSL PKKAGLQRCG KSCRLRWLNY 60 LKPGIKKGKF TPEEEDVIIQ FHALLGNRWA SIAKELPNRT DNDIKNHWNS CLKKRLKKSG 120 INPVTHEPMT VKTTTFEESM ASTTLSPSSS SSGSAKILNK LANGLSSRQY DLDRIKNILC 180 SQRVATSELK NDNIDTMETA SFNVPEWDEE KLRGFLEMDT MGWDTTS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-29 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA39G00162 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013602606.1 | 4e-99 | PREDICTED: transcription factor MYB34-like isoform X1 | ||||
Refseq | XP_013602607.1 | 4e-99 | PREDICTED: transcription factor MYB34-like isoform X2 | ||||
Swissprot | Q9LE63 | 2e-59 | MY106_ARATH; Transcription factor MYB106 | ||||
TrEMBL | A0A397Y3R6 | 6e-98 | A0A397Y3R6_BRACM; Uncharacterized protein | ||||
TrEMBL | A0A3P6GY89 | 5e-98 | A0A3P6GY89_BRAOL; Uncharacterized protein | ||||
STRING | Bo8g104210.1 | 1e-96 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18710.1 | 1e-90 | myb domain protein 47 |