PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AA37G00119

Organism

Aethionema arabicum

Taxonomic ID

228871

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema

Family

G2-like

Protein Properties

Length: 106aa MW: 12174.2 Da PI: 10.7077

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AA37G00119	genome	VEGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	105.8	2.4e-33	26	80	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprlrWt eLH+rFv av+qLGG++kAtPkti+++m vkgLtl+h+kSHLQk+R+ AA37G00119 26 KPRLRWTVELHQRFVYAVTQLGGPNKATPKTIMRVMRVKGLTLYHLKSHLQKFRS 80 79****************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	11.368	23	83	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	2.0E-31	23	80	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.13E-16	25	81	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	1.4E-23	26	81	IPR006447	Myb domain, plants
Pfam	PF00249	9.7E-7	28	78	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MLEDENIKRS MCVQDDSGLV LTTDPKPRLR WTVELHQRFV YAVTQLGGPN KATPKTIMRV 60 MRVKGLTLYH LKSHLQKFRS GKQPHKDYTK DCPRASSSGN MISRSM

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4r_A	8e-21	26	82	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	8e-21	26	82	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	8e-21	26	82	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	8e-21	26	82	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269\|PubMed:14614507, ECO:0000269\|PubMed:18523061, ECO:0000269\|PubMed:25081480, ECO:0000269\|PubMed:26239308, ECO:0000305\|PubMed:15592750}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AA37G00119

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269\|PubMed:15592750}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009106664.1	8e-48	PREDICTED: myb family transcription factor APL
Refseq	XP_013589860.1	7e-48	PREDICTED: myb family transcription factor APL
Refseq	XP_013650277.1	7e-48	myb family transcription factor APL
Refseq	XP_013726973.1	7e-48	myb family transcription factor APL
Refseq	XP_022545127.1	7e-50	myb family transcription factor APL-like
Swissprot	Q9SAK5	1e-48	APL_ARATH; Myb family transcription factor APL
TrEMBL	A0A078J370	6e-48	A0A078J370_BRANA; BnaA02g36130D protein
TrEMBL	A0A397YV04	2e-47	A0A397YV04_BRACM; Uncharacterized protein (Fragment)
STRING	XP_004173831.1	9e-50	(Cucumis sativus)
STRING	Bostr.20129s0378.1.p	2e-47	(Boechera stricta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM363	28	184

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G79430.2	5e-51	G2-like family protein

Publications ? help Back to Top
Martínez-Navarro AC,Galván-Gordillo SV,Xoconostle-Cázares B,Ruiz-Medrano R Vascular gene expression: a hypothesis. Front Plant Sci, 2013. 4: p. 261 [PMID:23882276] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kondo Y, et al. Vascular Cell Induction Culture System Using Arabidopsis Leaves (VISUAL) Reveals the Sequential Differentiation of Sieve Element-Like Cells. Plant Cell, 2016. 28(6): p. 1250-62 [PMID:27194709] Shibuta M,Abe M FE Controls the Transcription of Downstream Flowering Regulators Through Two Distinct Mechanisms in Leaf Phloem Companion Cells. Plant Cell Physiol., 2017. 58(11): p. 2017-2025 [PMID:29036620]