PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA32G01148 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 204aa MW: 24385.4 Da PI: 8.0269 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.4 | 8.1e-19 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd ll+++vk +G+g+W++Ia++ g++R++k+c++rw +yl AA32G01148 16 KGLWTVEEDNLLIHYVKSHGKGHWNRIAKKTGLKRCGKSCRLRWMNYL 63 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 56.6 | 5.7e-18 | 69 | 114 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g +T +E++l+++++++lG++ W++Ia++++ gRt++q+k++w+++l AA32G01148 69 KGHFTDQEEDLILRLHRLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 114 689*******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.172 | 11 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.08E-30 | 14 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.5E-16 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.6E-17 | 16 | 63 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.4E-24 | 17 | 70 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.58E-12 | 19 | 63 | No hit | No description |
PROSITE profile | PS51294 | 26.755 | 64 | 118 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-17 | 68 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.5E-17 | 69 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-26 | 71 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.28E-11 | 72 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MRIKKINEEE NNEYKKGLWT VEEDNLLIHY VKSHGKGHWN RIAKKTGLKR CGKSCRLRWM 60 NYLSPNVKKG HFTDQEEDLI LRLHRLLGNR WSLIAKRVPG RTDNQVKNYW NTHLSKKFRI 120 KNQRLISNVD DDDKVMNHLV KLSEDKTCIE DDQERVQNQE HGVDEDEEHK NYMNSSGWTH 180 HGDEFELSAL TYMMDFFDGQ YCSY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-28 | 11 | 118 | 22 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA32G01148 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010435623.1 | 1e-83 | PREDICTED: transcription factor WER-like isoform X1 | ||||
Swissprot | Q9SEI0 | 6e-82 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A1J3DFG5 | 4e-84 | A0A1J3DFG5_NOCCA; Transcription factor WER (Fragment) | ||||
STRING | XP_010435623.1 | 5e-83 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 5e-79 | myb domain protein 66 |