PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA32G00607 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 237aa MW: 27456.8 Da PI: 6.8757 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.3 | 4.6e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ed++l ++++++G +W++ ++ g+ R++k+c++rw +yl AA32G00607 14 KGPWTPLEDQILTNYIRLYGHSNWRALPKLAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 52.4 | 1.2e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l AA32G00607 67 RGNFTPHEEQTIINLHQLLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.0E-23 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 12.924 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.43E-29 | 10 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.4E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.07E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 23.946 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.7E-27 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.8E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.8E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.73E-9 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 237 aa Download sequence Send to blast |
MGRAPCCEKM GMKKGPWTPL EDQILTNYIR LYGHSNWRAL PKLAGLLRCG KSCRLRWINY 60 LRPDIKRGNF TPHEEQTIIN LHQLLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLNNNG 120 DTKDINNIEE AIVVAERSSS PSPQHYSNNN IEISTVTTSG NSNENKNYSI LMDDESFWSE 180 VISVDNSTEN WEKLLEKNNK SYESNSKLLL NNNDMEFWFD LFTTTHTIDE FLDIPNF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-26 | 14 | 117 | 7 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269|PubMed:24415840}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA32G00607 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:24415840}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009141138.1 | 1e-109 | PREDICTED: myb-related protein Myb4 | ||||
Refseq | XP_013634894.1 | 1e-109 | PREDICTED: myb-related protein Myb4-like | ||||
Refseq | XP_013634924.1 | 1e-109 | PREDICTED: myb-related protein Myb4-like | ||||
Refseq | XP_013655085.1 | 1e-109 | transcription factor MYB14 | ||||
Refseq | XP_013747195.1 | 1e-109 | transcription factor MYB14-like | ||||
Swissprot | Q9SJX8 | 1e-109 | MYB14_ARATH; Transcription factor MYB14 | ||||
TrEMBL | A0A0D3C3D0 | 1e-107 | A0A0D3C3D0_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A397ZV34 | 1e-107 | A0A397ZV34_BRACM; Uncharacterized protein | ||||
TrEMBL | M4DYW1 | 1e-107 | M4DYW1_BRARP; Uncharacterized protein | ||||
STRING | Bra021708.1-P | 1e-108 | (Brassica rapa) | ||||
STRING | Bo4g176020.1 | 1e-108 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 1e-111 | myb domain protein 14 |
Publications ? help Back to Top | |||
---|---|---|---|
|