PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA20G00007 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 159aa MW: 18869.9 Da PI: 9.0794 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103 | 1.6e-32 | 78 | 136 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++++prsYYrCt ++C+vkk+ver aedp++v++tYeg+H h+ AA20G00007 78 LDDGYRWRKYGQKVVKNTQHPRSYYRCTEEKCRVKKRVERLAEDPRMVITTYEGRHFHS 136 59*******************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 4.5E-34 | 63 | 136 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.19E-28 | 71 | 137 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.608 | 73 | 138 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.2E-37 | 78 | 137 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.6E-25 | 79 | 135 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:1901141 | Biological Process | regulation of lignin biosynthetic process | ||||
GO:1904369 | Biological Process | positive regulation of sclerenchyma cell differentiation | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MYAGYANKRN INESRDDDDD HDDGDDGKND DDNKQETSHR NTTSLGVVSA MKMKKLKTRR 60 KVREPRFCFK TLSEIDVLDD GYRWRKYGQK VVKNTQHPRS YYRCTEEKCR VKKRVERLAE 120 DPRMVITTYE GRHFHSPSNH LDQHDSLSSH LTPLSNFFW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-28 | 69 | 135 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-28 | 69 | 135 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA20G00007 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_195651.1 | 6e-71 | WRKY DNA-binding protein 13 | ||||
Swissprot | Q9SVB7 | 5e-72 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
TrEMBL | A0A1J3DJU8 | 7e-71 | A0A1J3DJU8_NOCCA; Putative WRKY transcription factor 13 | ||||
TrEMBL | A0A1J3HQM8 | 5e-70 | A0A1J3HQM8_NOCCA; Putative WRKY transcription factor 13 | ||||
STRING | AT4G39410.1 | 2e-70 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6106 | 27 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G39410.1 | 7e-75 | WRKY DNA-binding protein 13 |