PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA10G00370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family CO-like
Protein Properties Length: 379aa    MW: 42047.5 Da    PI: 5.572
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA10G00370genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.31.2e-061860440
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                r+C+++ +   + +Ce ++ +lC +C  + H        H++v
  AA10G00370 18 RTCDTCRSAACTVYCEADSAYLCTSCDAQVHAAnrvasrHERV 60
                79******99*********************556677778776 PP

2zf-B_box26.99.8e-0960105342
    zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                  r+C+ +e  ++ + C+ +   lC  C  e+H+       H++vp+
  AA10G00370  60 VRVCESCECAPAAFLCKADAASLCTACDAEIHSAnplarrHQRVPI 105
                 689*****************************66899999**9997 PP

3CCT68.32e-23310353144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae RpR+KGrF+k++
  AA10G00370 310 REARVLRYREKKKTRKFEKTIRYASRKAYAEIRPRIKGRFAKRT 353
                 9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.9071562IPR000315B-box-type zinc finger
SMARTSM003361.7E-81562IPR000315B-box-type zinc finger
CDDcd000211.04E-71862No hitNo description
PROSITE profilePS5011911.60458105IPR000315B-box-type zinc finger
PfamPF006431.7E-760105IPR000315B-box-type zinc finger
CDDcd000212.09E-761105No hitNo description
SMARTSM003365.0E-963105IPR000315B-box-type zinc finger
PROSITE profilePS5101716.42310352IPR010402CCT domain
PfamPF062033.7E-17310352IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MLKEESNESG GRENSWARTC DTCRSAACTV YCEADSAYLC TSCDAQVHAA NRVASRHERV  60
RVCESCECAP AAFLCKADAA SLCTACDAEI HSANPLARRH QRVPILPISG HSCSSMTTHH  120
PTPSETAVTD ADNGMMMGQE EGEDEDEDDR EVASWLLLNP GKNSGNNNNN PNNGFLFGVE  180
YLDLVDYNSN LDNQFADQYQ RDCGVPQRNF GGDGVVPLQV EESNGHLHHN QQNFQSTINY  240
TCSSGAQYNY NSSLKDLNHN VSILSMDISV VPESTASDIT VPHPRTPKGT TDQLSGPPTQ  300
MMHQLTPMDR EARVLRYREK KKTRKFEKTI RYASRKAYAE IRPRIKGRFA KRTDIEAEAE  360
QLFSTTLMSD TGYGIVPSF
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA10G00370
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010485482.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965020.0COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLI3RT180.0I3RT18_ARALL; Putative flowering-time constans protein
STRINGXP_010485482.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-164CONSTANS-like 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]