PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA1063G00001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 263aa MW: 30193.8 Da PI: 6.9533 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.2 | 3.8e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++q+G+g+W++++ g+ R+ k+c++rw +yl AA1063G00001 14 KGPWTPEEDIILVSYIQQHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 44.1 | 4.7e-14 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T E+ ++++ +lG++ W++Ia++++ Rt++++k++w+++l AA1063G00001 67 RGNFTSHEEGMIIHLQSLLGNK-WASIASYLP-QRTDNDIKNYWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.0E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.003 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.83E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.5E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.6E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.55E-10 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.2E-24 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.3E-12 | 66 | 114 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.212 | 66 | 116 | IPR017930 | Myb domain |
Pfam | PF00249 | 4.5E-12 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.45E-7 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010118 | Biological Process | stomatal movement | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 263 aa Download sequence Send to blast |
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ QHGPGNWRSV PTNTGLLRCS KSCRLRWTNY 60 LRPGIKRGNF TSHEEGMIIH LQSLLGNKWA SIASYLPQRT DNDIKNYWNT HLKKKLNKSH 120 LTSECDEKNT ADNISVQNST ARNIIMNHRS TYASSTENIS RLLEGWMRAS PKNSSDFEKN 180 NRIDHNQLKG SWEEDHSKRI KDFDVSKKLL NDHHDDSDDV DVDDDQNVPP PLTFIEKWLL 240 EETTSGGGHI EEMSHLMELS NML |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-24 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light) (PubMed:16005291, PubMed:21637967). Promotes guard cell deflation in response to water deficit. Triggers root growth upon osmotic stress (e.g. mannitol containing medium) (PubMed:21637967). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:21637967}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00132 | DAP | Transfer from AT1G08810 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA1063G00001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by jasmonic acid (JA) and salicylic acid (SA) (PubMed:16463103). Triggered by auxin (IAA) in roots (PubMed:9839469, PubMed:21637967). Stimulated by light, UV-light and cold (PubMed:9839469). According to PubMed:16005291 and PubMed:23828545, rapidly repressed by abscisic acid (ABA) in an ABI1-dependent manner. But in contrast, according to PubMed:21637967, transiently induced by ABA in seedlings (PubMed:16005291, PubMed:21637967, PubMed:23828545). Rapidly repressed by drought. Activated by white light, but repressed by blue light and darkness (PubMed:16005291). Transiently induced by salt (NaCl) in seedlings. Induced by sucrose (PubMed:21637967). Positively regulated by SCAP1 (PubMed:23453954). {ECO:0000269|PubMed:16005291, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:21637967, ECO:0000269|PubMed:23453954, ECO:0000269|PubMed:23828545, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_172358.1 | 1e-136 | myb domain protein 60 | ||||
Swissprot | Q8GYP5 | 1e-137 | MYB60_ARATH; Transcription factor MYB60 | ||||
TrEMBL | A0A178WD25 | 1e-135 | A0A178WD25_ARATH; MYB60 | ||||
STRING | AT1G08810.1 | 1e-135 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08810.1 | 1e-135 | myb domain protein 60 |
Publications ? help Back to Top | |||
---|---|---|---|
|