PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA1026G00001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 233aa MW: 27339.7 Da PI: 8.255 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 94.2 | 6e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvt+skRrng++KKA+EL vLCda+v++i+fss++kl+ey+s AA1026G00001 9 KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYIS 59 79***********************************************86 PP | |||||||
2 | K-box | 80.5 | 4e-27 | 71 | 169 | 1 | 99 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 yq++sg +++++++e++q+ +kL + ++nL+++++++lG++L++L++ eL++Le+++++ + +R++K++ l +qie+++kk+k++q+++k+L ++ AA1026G00001 71 YQTASGIDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGDCLDELDFDELHHLEEEMDNTFRLVRERKMKSLSNQIETTKKKNKSQQDIQKNLIHE 167 89999*****************************************************************************************998 PP K-box 98 le 99 le AA1026G00001 168 LE 169 75 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.142 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.0E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.73E-40 | 2 | 80 | No hit | No description |
PRINTS | PR00404 | 6.2E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.22E-36 | 3 | 94 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.4E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.2E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.2E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.6E-16 | 82 | 168 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.849 | 84 | 174 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 233 aa Download sequence Send to blast |
MARGKIQIKR IENQTNRQVT YSKRRNGLFK KAHELTVLCD ARVSIIMFSS SNKLHEYISP 60 NTTTKEIIDL YQTASGIDVW STQYERMQET KRKLLETNRN LRTQIKQRLG DCLDELDFDE 120 LHHLEEEMDN TFRLVRERKM KSLSNQIETT KKKNKSQQDI QKNLIHELEL RAEDPHYGLV 180 DNGGDYDSVL GYQIEGSRGY ALRYHQNHNN HHYSSHALHA PSASDIITFH LLE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 5e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_B | 5e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_C | 5e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_D | 5e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_A | 5e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_B | 5e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_C | 5e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_D | 5e-18 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269|PubMed:18417639, ECO:0000269|PubMed:8565821, ECO:0000269|PubMed:9489703}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00077 | ChIP-seq | Transfer from AT3G54340 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA1026G00001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269|PubMed:11283333, ECO:0000269|PubMed:19783648}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020879680.1 | 1e-158 | floral homeotic protein APETALA 3 | ||||
Swissprot | P35632 | 1e-156 | AP3_ARATH; Floral homeotic protein APETALA 3 | ||||
TrEMBL | D7LUS9 | 1e-156 | D7LUS9_ARALL; APETALA3 | ||||
STRING | fgenesh2_kg.5__1825__AT3G54340.1 | 1e-157 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5261 | 27 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54340.1 | 1e-134 | MIKC_MADS family protein |