PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aan017097 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 98aa MW: 11767.7 Da PI: 10.6172 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 27.8 | 4.2e-09 | 53 | 87 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yp++e++++L +++gL+ +q+ +WF N+R +e Aan017097 53 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKRE 87 469*****************************986 PP | |||||||
2 | ELK | 31.7 | 3.5e-11 | 7 | 28 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELKh+L+++Y+++++++++E++ Aan017097 7 ELKHELKQGYKEKIVDIREEIL 28 9*******************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03789 | 1.3E-7 | 7 | 28 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 9.969 | 7 | 27 | IPR005539 | ELK domain |
SMART | SM01188 | 6.1E-4 | 7 | 28 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 11.321 | 27 | 90 | IPR001356 | Homeobox domain |
SMART | SM00389 | 3.6E-10 | 29 | 94 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 8.98E-17 | 29 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 2.69E-9 | 30 | 87 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.3E-25 | 34 | 87 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 9.9E-19 | 47 | 86 | IPR008422 | Homeobox KN domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MERVRQELKH ELKQGYKEKI VDIREEILRK RRAGKLPGDT TSLLKAWWQS HSKWPYPTEE 60 DKARLVQETG LQLKQINNWF INQRKREIGT VILHPPLL |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Maximally expressed in sepals, petals and fully expanded leaves. Also expressed in other flower organs and in developing leaves. Low level expression in stem internodes. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028104354.1 | 2e-56 | homeobox protein knotted-1-like 3 isoform X1 | ||||
Swissprot | O04136 | 4e-55 | KNAP3_MALDO; Homeobox protein knotted-1-like 3 | ||||
TrEMBL | A0A0B2Q1W0 | 2e-55 | A0A0B2Q1W0_GLYSO; Homeobox protein knotted-1-like 4 | ||||
TrEMBL | A0A445IZ02 | 6e-55 | A0A445IZ02_GLYSO; Homeobox protein knotted-1-like 3 isoform B | ||||
STRING | Cagra.0628s0006.1.p | 2e-55 | (Capsella grandiflora) | ||||
STRING | POPTR_0006s27560.1 | 2e-55 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G25220.2 | 1e-57 | KNOTTED1-like homeobox gene 3 |