PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Aan016550 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||||||
Family | WRKY | ||||||||||||
Protein Properties | Length: 147aa MW: 16699.3 Da PI: 9.8721 | ||||||||||||
Description | WRKY family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 84.4 | 1.1e-26 | 93 | 143 | 1 | 51 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEE CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveit 51 ldDgy+WrKYGqK vk+s+fpr+YY+Ctsa+C+vkk++er+ +dp++v++t Aan016550 93 LDDGYRWRKYGQKAVKNSHFPRGYYKCTSASCNVKKRIERCMSDPSYVVTT 143 59*********************************************9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.5E-27 | 78 | 143 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.22E-23 | 85 | 143 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 24.409 | 88 | 147 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.3E-24 | 93 | 145 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.7E-19 | 94 | 143 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
XANNNGDLDY KKDDVITTAD EETSSVVLSG QQQPSSPNSS CISSPAHQLL HKPNKQCMKA 60 KKTMSGNETK TTKKKKEKEA RFAFMTRTEI DHLDDGYRWR KYGQKAVKNS HFPRGYYKCT 120 SASCNVKKRI ERCMSDPSYV VTTDTRX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 8e-22 | 83 | 143 | 7 | 67 | Probable WRKY transcription factor 4 |
2lex_A | 8e-22 | 83 | 143 | 7 | 67 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021969411.1 | 3e-56 | probable WRKY transcription factor 23 | ||||
Swissprot | O22900 | 9e-34 | WRK23_ARATH; WRKY transcription factor 23 | ||||
TrEMBL | A0A2U1LCI4 | 2e-77 | A0A2U1LCI4_ARTAN; WRKY domain-containing protein | ||||
STRING | Solyc01g079260.2.1 | 1e-38 | (Solanum lycopersicum) | ||||
STRING | PGSC0003DMT400023368 | 1e-38 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47260.1 | 1e-33 | WRKY DNA-binding protein 23 |
Publications ? help Back to Top | |||
---|---|---|---|
|