PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aan013386 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 141aa MW: 16210.3 Da PI: 8.8764 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 135.3 | 1.9e-42 | 57 | 133 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 +CqvegC++d++++k+yhrrhkvCevh+kap v+++g +qrfCqqCsrfh+lsefD++krsCrrrLa+hnerrrk++ Aan013386 57 CCQVEGCTTDMTNCKTYHRRHKVCEVHAKAPIVVTNGCQQRFCQQCSRFHDLSEFDDAKRSCRRRLAGHNERRRKTT 133 6**************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 4.0E-55 | 4 | 140 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 1.5E-33 | 50 | 119 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.787 | 55 | 132 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.44E-38 | 56 | 136 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.2E-32 | 58 | 131 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
METTKSGRVV KIMNNKLKNV MMDECEDDDD ENFGEGRRKK KVLGKRGSGS AGSIQPCCQV 60 EGCTTDMTNC KTYHRRHKVC EVHAKAPIVV TNGCQQRFCQ QCSRFHDLSE FDDAKRSCRR 120 RLAGHNERRR KTTYENYDGN L |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 7e-37 | 48 | 131 | 3 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024988508.1 | 5e-73 | squamosa promoter-binding protein 1-like | ||||
Swissprot | Q38741 | 2e-48 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A103XU00 | 1e-71 | A0A103XU00_CYNCS; Squamosa promoter-binding-like protein | ||||
STRING | EOY13069 | 4e-45 | (Theobroma cacao) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 6e-30 | squamosa promoter binding protein-like 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|