PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aan011127 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 138aa MW: 16230.3 Da PI: 9.6822 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 32.1 | 1.9e-10 | 63 | 98 | 20 | 55 |
HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 +k +yps++e+ LA+++gL+++q+ +WF N+R ++ Aan011127 63 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 98 5679*****************************985 PP | |||||||
2 | ELK | 39.7 | 1e-13 | 18 | 39 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++LlrKYsgyL+sLkqE+s Aan011127 18 ELKNHLLRKYSGYLSSLKQELS 39 9*******************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51213 | 11.296 | 18 | 38 | IPR005539 | ELK domain |
Pfam | PF03789 | 6.8E-11 | 18 | 39 | IPR005539 | ELK domain |
SMART | SM01188 | 3.5E-7 | 18 | 39 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 13.086 | 38 | 101 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 5.99E-21 | 39 | 114 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 2.4E-13 | 40 | 105 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-28 | 43 | 104 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 3.33E-12 | 50 | 102 | No hit | No description |
Pfam | PF05920 | 2.2E-17 | 58 | 97 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 76 | 99 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
XVGETEVPEI DPRAEDRELK NHLLRKYSGY LSSLKQELSK KKKKGKLPKE ARQKLLSWWE 60 LHYKWPYPSE SEKVALAEST GLDQKQINNW FINQRKRHWK PSEDMQFMVM DGPHPQNAAT 120 ALYMEGHYMG EGPYRLGP |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the apical meristems, in the newly emerged lateral primordia in the floral bud, in their vascular bundles and in the cortex parenchyma of the floral pedicle. Also present in the lateral tips of leaf primordia. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed only in the stems. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Appears to be involved in meristem formation and in the regulation of leaf morphology. Misexpression makes the leaf more compound which is always associated with growth retardation and loss of apical dominance, resulting in dwarfed, bushy plants. Probably binds to the DNA sequence 5'-TGAC-3'. | |||||
UniProt | Probably binds to the DNA sequence 5'-TGAC-3'. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023731900.1 | 5e-84 | homeotic protein knotted-1 isoform X1 | ||||
Refseq | XP_023731901.1 | 4e-84 | homeotic protein knotted-1 isoform X2 | ||||
Swissprot | O04135 | 6e-81 | KNAP2_MALDO; Homeobox protein knotted-1-like 2 | ||||
Swissprot | Q41330 | 4e-81 | KN1_SOLLC; Homeotic protein knotted-1 | ||||
TrEMBL | A0A2J6KJX9 | 1e-82 | A0A2J6KJX9_LACSA; Uncharacterized protein | ||||
STRING | EOY15624 | 4e-81 | (Theobroma cacao) | ||||
STRING | XP_002510027.1 | 4e-82 | (Ricinus communis) | ||||
STRING | XP_009598343.1 | 3e-81 | (Nicotiana tomentosiformis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G08150.1 | 5e-73 | KNOTTED-like from Arabidopsis thaliana |