PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Aan009810 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||||||
Family | NF-YB | ||||||||||||
Protein Properties | Length: 176aa MW: 19089 Da PI: 5.6782 | ||||||||||||
Description | NF-YB family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 184 | 1.1e-57 | 26 | 122 | 2 | 98 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 reqdrflPian+srimkk lPan+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfedy++plk+yl++yreleg++k Aan009810 26 REQDRFLPIANISRIMKKGLPANGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIDPLKAYLSRYRELEGDTK 122 89********************************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.6E-53 | 20 | 134 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.55E-40 | 28 | 133 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.7E-28 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.9E-21 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 8.9E-21 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 8.9E-21 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MADVPGSPAG GSHESGGEQS PHSNIREQDR FLPIANISRI MKKGLPANGK IAKDAKDTVQ 60 ECVSEFISFV TSEASDKCQK EKRKTINGDD LLWAMATLGF EDYIDPLKAY LSRYRELEGD 120 TKGSARGGDG SGKKDAVGSQ LVPNAQYTHQ GSFCTGNEIF LNSHVLTSNK EDMNLX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-46 | 25 | 116 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-46 | 25 | 116 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024976536.1 | 1e-106 | nuclear transcription factor Y subunit B-1-like | ||||
Refseq | XP_024976545.1 | 1e-106 | nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | Q8VYK4 | 3e-80 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A1B0T703 | 1e-113 | A0A1B0T703_CHRMO; NF-Y protein (Fragment) | ||||
TrEMBL | A0A2U1QNJ1 | 1e-113 | A0A2U1QNJ1_ARTAN; NF-Y protein | ||||
STRING | cassava4.1_017552m | 3e-93 | (Manihot esculenta) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 1e-82 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|