PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Aan004492 | ||||||||||||||||
Organism | |||||||||||||||||
Taxonomic ID | |||||||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||||||||||
Family | NF-YB | ||||||||||||||||
Protein Properties | Length: 171aa MW: 18561.7 Da PI: 5.9916 | ||||||||||||||||
Description | NF-YB family protein | ||||||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 183.5 | 1.7e-57 | 28 | 124 | 2 | 98 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 reqdrflPian+srimkk +Pan+ki+kdaketvqecvsefisf+tseasdkcq+ekrkting+dllwa+atlGfedy+eplk yl++yre+eg++k Aan004492 28 REQDRFLPIANISRIMKKGVPANGKIAKDAKETVQECVSEFISFITSEASDKCQKEKRKTINGEDLLWAMATLGFEDYIEPLKRYLSRYREMEGDTK 124 89********************************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.9E-54 | 25 | 136 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.4E-41 | 30 | 134 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.3E-28 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.8E-22 | 61 | 79 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.8E-22 | 80 | 98 | No hit | No description |
PRINTS | PR00615 | 3.8E-22 | 99 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MAEGPASPCG GGSHESGGDM SPRAGNAREQ DRFLPIANIS RIMKKGVPAN GKIAKDAKET 60 VQECVSEFIS FITSEASDKC QKEKRKTING EDLLWAMATL GFEDYIEPLK RYLSRYREME 120 GDTKGSAKGQ DGSASRNGMQ PDLNAQLGSQ GFYSQGLTYG NSQLDSIRLN I |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-47 | 28 | 118 | 3 | 93 | NF-YB |
4awl_B | 2e-47 | 28 | 118 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-47 | 28 | 118 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021973198.1 | 1e-97 | nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
Swissprot | Q8VYK4 | 7e-80 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A251UBF1 | 1e-95 | A0A251UBF1_HELAN; Putative histone-fold protein | ||||
STRING | XP_009767971.1 | 3e-94 | (Nicotiana sylvestris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 3e-82 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|