PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Aan004469 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||||||
Family | NF-YB | ||||||||||||
Protein Properties | Length: 174aa MW: 19241.4 Da PI: 6.3592 | ||||||||||||
Description | NF-YB family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 185.2 | 5e-58 | 26 | 123 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 vreqdrflPian+srimkk+lPan+k++kdaketvqecvsefisfvtseasdkcqrekrktingddllwa+atlGfedy+eplk+yl++yre+eg++k Aan004469 26 VREQDRFLPIANISRIMKKALPANGKMAKDAKETVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKLYLSRYREMEGDTK 123 69*********************************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.5E-54 | 23 | 137 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.16E-41 | 29 | 135 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.4E-28 | 32 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.3E-21 | 60 | 78 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 63 | 79 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.3E-21 | 79 | 97 | No hit | No description |
PRINTS | PR00615 | 1.3E-21 | 98 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MAEGPASPGG GSHESGGDLS PRSSNVREQD RFLPIANISR IMKKALPANG KMAKDAKETV 60 QECVSEFISF VTSEASDKCQ REKRKTINGD DLLWAMATLG FEDYIEPLKL YLSRYREMEG 120 DTKGSGKGHE GSARKDGAQP DYREHLAHQG SYLQGLDYGN QQAQHMMVQM QGRD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 8e-48 | 25 | 117 | 1 | 93 | NF-YB |
4awl_B | 8e-48 | 25 | 117 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 8e-48 | 25 | 117 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Aan.19902 | 0.0 | trichome |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021973197.1 | 1e-108 | nuclear transcription factor Y subunit B-8-like isoform X1 | ||||
Refseq | XP_021973199.1 | 1e-108 | nuclear transcription factor Y subunit B-8-like isoform X3 | ||||
Refseq | XP_024977724.1 | 1e-109 | nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | Q8VYK4 | 9e-88 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A1B0T702 | 1e-126 | A0A1B0T702_CHRMO; NF-Y protein (Fragment) | ||||
STRING | XP_009620316.1 | 1e-101 | (Nicotiana tomentosiformis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 4e-90 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|