PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KFK45149.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 143aa MW: 15996.8 Da PI: 6.9379 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 62.1 | 1.1e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+d+++++G g+W++ ++ ++R++k+c++rw +yl KFK45149.1 14 KGPWTPEEDQKLIDYIHKHGHGSWRALPKLADLNRCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 31.1 | 5.5e-10 | 67 | 98 | 1 | 34 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkg 34 rg+++teE++ +++++ lG++ W++Ia +++ g KFK45149.1 67 RGKFSTEEEQTILHLHSILGNK-WSAIATHLQ-G 98 89********************.********9.4 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.3E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.01 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 1.9E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.9E-18 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.77E-27 | 15 | 92 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.76E-12 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.7E-15 | 65 | 98 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 7.913 | 66 | 109 | IPR017930 | Myb domain |
SMART | SM00717 | 1.5 | 66 | 102 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-8 | 67 | 98 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MGRSPCCDEN GLKKGPWTPE EDQKLIDYIH KHGHGSWRAL PKLADLNRCG KSCRLRWTNY 60 LRPDIKRGKF STEEEQTILH LHSILGNKWS AIATHLQGHH NPNDAPPSLP ADASSSSSYG 120 GGDGASLYWP DFCFDENIIN DIS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-20 | 12 | 98 | 5 | 90 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KFK45149.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519560 | 1e-120 | AY519560.1 Arabidopsis thaliana MYB transcription factor (At1g34670) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013659543.1 | 4e-67 | transcription factor MYB41-like | ||||
Refseq | XP_013674792.1 | 4e-67 | transcription factor MYB41-like | ||||
Swissprot | Q9S9Z2 | 1e-67 | MYB93_ARATH; Transcription factor MYB93 | ||||
TrEMBL | A0A087HSP7 | 1e-102 | A0A087HSP7_ARAAL; Uncharacterized protein | ||||
STRING | A0A087HSP7 | 1e-103 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G34670.1 | 1e-69 | myb domain protein 93 |
Publications ? help Back to Top | |||
---|---|---|---|
|