PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KFK43105.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 123aa MW: 14633.7 Da PI: 5.2567 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 36.5 | 1.1e-11 | 14 | 58 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 g W Ede+l av ++G ++W++I++ + ++++kqc +rw+ + KFK43105.1 14 GVWKNTEDEILNVAVMKYGLNQWDRISSLLV-RKSPKQCEDRWYEW 58 68*****************************.***********987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 2.42E-12 | 8 | 58 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 10.537 | 8 | 63 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-12 | 10 | 58 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.2E-10 | 12 | 61 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-10 | 14 | 58 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.90E-9 | 16 | 58 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.8E-7 | 60 | 100 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.73E-9 | 61 | 104 | IPR009057 | Homeodomain-like |
CDD | cd11659 | 2.80E-20 | 61 | 102 | No hit | No description |
Pfam | PF13921 | 1.8E-8 | 62 | 105 | No hit | No description |
SMART | SM00717 | 0.031 | 62 | 105 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS50090 | 6.829 | 62 | 103 | IPR017877 | Myb-like domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 123 aa Download sequence Send to blast |
MTMTMTMTIK MNQGVWKNTE DEILNVAVMK YGLNQWDRIS SLLVRKSPKQ CEDRWYEWQA 60 EWSREEDEKL MHIAKLMPNQ WRSIALIVGF SPTQCFERYE FLRSKENYQA ADDPNPESKA 120 CTS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5mqf_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
5xjc_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
5yzg_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
5z56_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
5z57_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
5z58_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
6ff4_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
6ff7_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
6icz_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
6id0_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
6id1_L | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
6qdv_O | 1e-40 | 9 | 121 | 4 | 137 | Cell division cycle 5-like protein |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KFK43105.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC254583 | 4e-34 | AC254583.1 Capsella rubella clone JGIBSIA-25G5, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_005851759.1 | 1e-47 | hypothetical protein CHLNCDRAFT_33512, partial | ||||
Refseq | XP_010528754.1 | 3e-46 | PREDICTED: cell division cycle 5-like protein | ||||
Swissprot | P92948 | 2e-46 | CDC5L_ARATH; Cell division cycle 5-like protein | ||||
TrEMBL | A0A087HLV3 | 8e-88 | A0A087HLV3_ARAAL; Uncharacterized protein | ||||
STRING | A0A087HLV3 | 1e-88 | (Arabis alpina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09770.1 | 6e-48 | cell division cycle 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|