PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK41461.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family TALE
Protein Properties Length: 308aa    MW: 35321.7 Da    PI: 4.8004
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK41461.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.6e-092512852155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 k +yp++ ++  LA+++gL+++q+ +WF N+R ++
  KFK41461.1 251 KWPYPTEGDKIALAEETGLDQKQINNWFINQRKRH 285
                 569*****************************885 PP

2ELK33.77.9e-12205226122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 +LK+qLlrK++++++sLk EFs
  KFK41461.1 205 DLKDQLLRKFGSHISSLKLEFS 226
                 6********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.5E-2164108IPR005540KNOX1
PfamPF037907.5E-2066107IPR005540KNOX1
SMARTSM012561.3E-27115166IPR005541KNOX2
PfamPF037912.3E-25119165IPR005541KNOX2
PROSITE profilePS512139.935205225IPR005539ELK domain
SMARTSM011884.2E-6205226IPR005539ELK domain
PfamPF037897.2E-9205226IPR005539ELK domain
PROSITE profilePS5007112.633225288IPR001356Homeobox domain
SuperFamilySSF466892.57E-19226298IPR009057Homeodomain-like
SMARTSM003891.4E-12227292IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.1E-28230289IPR009057Homeodomain-like
CDDcd000862.27E-11234289No hitNo description
PfamPF059209.3E-18245284IPR008422Homeobox KN domain
PROSITE patternPS000270263286IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0010094Biological Processspecification of carpel identity
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MMITSSENLM SPSDFQNLIY SSTGDNNNNR VFGSNELLSA SETASIITPR IRRSHGDDNS  60
FSLGVIKTKI ACHPLYPRLL QTYIDCQKVG APLEIACLLE EIQRENDVYK RDLGPLSCFG  120
ADPELDEFME TYCDILVKYK SDLARPFDEA TTFLNKIEMQ LQNLCTGPPC TRDVSDDGAV  180
SSDEELREGD HVATQDSQQR SEDRDLKDQL LRKFGSHISS LKLEFSKKKK KGKLPREARQ  240
ALLDWWSVHY KWPYPTEGDK IALAEETGLD QKQINNWFIN QRKRHWKPSE NMPFAMMDDS  300
SETFFIEE
Functional Description ? help Back to Top
Source Description
UniProtMay play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK41461.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020889993.11e-174homeobox protein knotted-1-like 2
SwissprotP466401e-175KNAT2_ARATH; Homeobox protein knotted-1-like 2
TrEMBLA0A087HH590.0A0A087HH59_ARAAL; Uncharacterized protein
STRINGA0A087HH590.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8352785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.11e-169KNOTTED-like from Arabidopsis thaliana 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Zhang XL,Yang ZP,Zhang J,Zhang LG
    Ectopic expression of BraYAB1-702, a member of YABBY gene family in Chinese cabbage, causes leaf curling, inhibition of development of shoot apical meristem and flowering stage delaying in Arabidopsis thaliana.
    Int J Mol Sci, 2013. 14(7): p. 14872-91
    [PMID:23863694]
  3. Kuijt SJ, et al.
    Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors.
    Plant Physiol., 2014. 164(4): p. 1952-66
    [PMID:24532604]
  4. Scofield S,Dewitte W,Murray JA
    STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1.
    Plant Signal Behav, 2018.
    [PMID:24776954]
  5. Lee JE,Lampugnani ER,Bacic A,Golz JF
    SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis.
    Plant J., 2014. 80(1): p. 122-35
    [PMID:25060324]
  6. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  7. Li Z, et al.
    Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis.
    J Integr Plant Biol, 2016. 58(12): p. 959-970
    [PMID:27273574]
  8. Lozano-Sotomayor P, et al.
    Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.
    Plant J., 2016. 88(3): p. 437-451
    [PMID:27402171]