PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK37702.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family CO-like
Protein Properties Length: 324aa    MW: 36689.6 Da    PI: 5.6622
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK37702.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.54.8e-071456440
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                r+C+++ +   + +Ce ++ +lC +C   +H        H++v
  KFK37702.1 14 RTCDTCRSAACTVYCEADSAYLCTTCDARIHAAnrvasrHERV 56
                79******99*********************656677778776 PP

2zf-B_box33.11.2e-1056101342
    zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                  r+C+++e+ ++ + C+ +   lC  C +e+H+       H++vp+
  KFK37702.1  56 VRVCQQCESAPAAFLCKADAASLCIACDTEIHSAnplarrHQRVPI 101
                 689*****************************66899999**9997 PP

3CCT68.91.3e-23260303144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea+++RY+eK+ktRkFeK+irY+sRKa+Ae RpR+KGrF+k++
  KFK37702.1 260 REARVMRYREKKKTRKFEKTIRYASRKAYAEIRPRIKGRFAKRT 303
                 9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.7081158IPR000315B-box-type zinc finger
SMARTSM003363.6E-91158IPR000315B-box-type zinc finger
CDDcd000216.84E-81458No hitNo description
PROSITE profilePS5011911.57654101IPR000315B-box-type zinc finger
PfamPF006431.5E-856101IPR000315B-box-type zinc finger
CDDcd000213.33E-957101No hitNo description
SMARTSM003362.7E-1059101IPR000315B-box-type zinc finger
PROSITE profilePS5101716.529260302IPR010402CCT domain
PfamPF062031.3E-17260302IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MLKEESNESG TWARTCDTCR SAACTVYCEA DSAYLCTTCD ARIHAANRVA SRHERVRVCQ  60
QCESAPAAFL CKADAASLCI ACDTEIHSAN PLARRHQRVP ITHQSNPSET DADNDEDDQE  120
VASWLLLNPG KNQNNGFLFG VEYLDLVDYN STMENQYEDQ YNRYQRSFGG DGVVPLQVEE  180
STTNHLQQNQ HDDFQLGINF GYNNYNGSLK NLNHSVSISS MDNISVVPES TTVQENSRIT  240
KETIDQVSGP LVQQLSPMDR EARVMRYREK KKTRKFEKTI RYASRKAYAE IRPRIKGRFA  300
KRTETEVDDA EQLFSRGYGI VPSL
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK37702.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ1802769e-62JQ180276.1 Arabidopsis halleri subsp. gemmifera putative flowering-time constans protein (COL2) gene, complete cds.
GenBankJQ1802779e-62JQ180277.1 Arabidopsis halleri subsp. halleri putative flowering-time constans protein (COL2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010485482.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965020.0COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLA0A087H6F00.0A0A087H6F0_ARAAL; Uncharacterized protein
STRINGA0A087H6F00.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-174CONSTANS-like 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]